MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint zhang-2017-33 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang Y., Wu M., Hang T., Wang C., Yang Y., Pan W., Zang J., Zhang M., Zhang X., Zhang Y., Wu M., Hang T., Wang C., Yang Y., Pan W., Zang J., Zhang M., Zhang X. xuanzbin@ustc.edu.cn; zhmin07@ustc.edu The Biochemical journal 2017 Only protein-protein interactions imex curation imex curation zhang-2017-34 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Zhang Y., Wu M., Hang T., Wang C., Yang Y., Pan W., Zang J., Zhang M., Zhang X., Zhang Y., Wu M., Hang T., Wang C., Yang Y., Pan W., Zang J., Zhang M., Zhang X. xuanzbin@ustc.edu.cn; zhmin07@ustc.edu The Biochemical journal 2017 Only protein-protein interactions imex curation imex curation zhang-2017-35 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zhang Y., Wu M., Hang T., Wang C., Yang Y., Pan W., Zang J., Zhang M., Zhang X., Zhang Y., Wu M., Hang T., Wang C., Yang Y., Pan W., Zang J., Zhang M., Zhang X. xuanzbin@ustc.edu.cn; zhmin07@ustc.edu The Biochemical journal 2017 Only protein-protein interactions imex curation imex curation zhang-2017-36 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhang Y., Wu M., Hang T., Wang C., Yang Y., Pan W., Zang J., Zhang M., Zhang X., Zhang Y., Wu M., Hang T., Wang C., Yang Y., Pan W., Zang J., Zhang M., Zhang X. xuanzbin@ustc.edu.cn; zhmin07@ustc.edu The Biochemical journal 2017 Only protein-protein interactions imex curation imex curation cfah_human Complement factor H CFH HF HF1 HF2 H factor 1 protein protein human Homo sapiens Human MRLLAKIICLMLWAICVAEDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCIKSCDIPVFMNARTKNDFTWFKLNDTLDYECHDGYESNTGSTTGSIVCGYNGWSDLPICYERECELPKIDVHLVPDRKKDQYKVGEVLKFSCKPGFTIVGPNSVQCYHFGLSPDLPICKEQVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAIDKLKKCKSSNLIILEEHLKNKKEFDHNSNIRYRCRGKEGWIHTVCINGRWDPEVNCSMAQIQLCPPPPQIPNSHNMTTTLNYRDGEKVSVLCQENYLIQEGEEITCKDGRWQSIPLCVEKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCEGLPCKSPPEISHGVVAHMSDSYQYGEEVTYKCFEGFGIDGPAIAKCLGEKWSHPPSCIKTDCLSLPSFENAIPMGEKKDVYKAGEQVTYTCATYYKMDGASNVTCINSRWTGRPTCRDTSCVNPPTVQNAYIVSRQMSKYPSGERVRYQCRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCAKR sdre_staam Serine-aspartate repeat-containing protein E sdrE SAV0563 protein protein staam Staphylococcus aureus (strain Mu50 / ATCC 700699) MINRDNKKAITKKGMISNRLNKFSIRKYTVGTASILVGTTLIFGLGNQEAKAAENTSTENAKQDDATTSDNKEVVSETENNSTTENDSTNPIKKETNTDSQPEAKEESTTSSTQQQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNYTNNDVTTKPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKNNPEKLKELVRNDNNTDRSTKPVATAPTSVAPKRLNAKMRFAVAQPAAVASNNVNDLITVTKQTIKVGDGKDNVAAAHDGKDIEYDTEFTIDNKVKKGDTMTINYDKNVIPSDLTDKNDPIDITDPSGEVIAKGTFDKATKQITYTFTDYVDKYEDIKARLTLYSYIDKQAVPNETSLNLTFATAGKETSQNVSVDYQDPMVHGDSNIQSIFTKLDENKQTIEQQIYVNPLKKTATNTKVDIAGSQVDDYGNIKLGNGSTIIDQNTEIKVYKVNPNQQLPQSNRIYDFSQYEDVTSQFDNKKSFSNNVATLDFGDINSAYIIKVVSKYTPTSDGELDIAQGTSMRTTDKYGYYNYAGYSNFIVTSNDTGGGDGTVKPEEKLYKIGDYVWEDVDKDGVQGTDSKEKPMANVLVTLTYPDGTTKSVRTDANGHYEFGGLKDGETYTVKFETPAGYLPTKVNGTTDGEKDSNGSSITVKINGKDDMSLDTGFYKEPKYNLGDYVWEDTNKDGIQDANEPGIKDVKVTLKDSTGKVIGTTTTDASGKYKFTDLDNGNYTVEFETPAGYTPTVKNTTAEDKDSNGLTTTGVIKDADNMTLDSGFYKTPKYSLGDYVWYDSNKDGKQDSTEKGIKDVKVTLLNEKGEVIGTTKTDENGKYRFDNLDSGKYKVIFEKPAGLTQTVTNTTEDDKDADGGEVDVTITDHDDFILDNGYFEEDTSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDAGKHTPVKPMSTTKDHHNKAKALPETGSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK cfh-sdre-1 3943213 N/A 3943217 unspecified role unspecified role neutral component neutral component purified purified binding range binding range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 2.0 N/A 3943218 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false binding range binding range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false F3A F3D T1 SF2B cfh-sdre-3 3943214 N/A 3943217 unspecified role unspecified role neutral component neutral component purified purified binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 3943218 unspecified role unspecified role neutral component neutral component purified purified binding range binding range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3943214 F1E cfh-sdre-2 3943215 N/A 3943217 unspecified role unspecified role neutral component neutral component purified purified P08603:p.Ser1208Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P08603:p.Arg1210Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P08603:p.Ser1211Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P08603:p.His1212Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P08603:p.Thr1213Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P08603:p.Leu1214Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P08603:p.Arg1215Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P08603:p.Thr1216Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P08603:p.Thr1217Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P08603:p.Arg1206Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P08603:p.Leu1207Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P08603:p.Cys1218Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P08603:p.Trp1219Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P08603:p.Asp1220Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P08603:p.Lys1222Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P08603:p.Leu1223Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P08603:p.Glu1224Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P08603:p.Tyr1225Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P08603:p.Pro1226Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P08603:p.Ser1209Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 3943218 unspecified role unspecified role neutral component neutral component purified purified Q932F7:p.Asp334Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q932F7:p.Leu335Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q932F7:p.Gln419Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q932F7:p.Asp588Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false binding range binding range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false F1B F1C F1D F3B F3C cfh-sdre-4 3943216 N/A 3943217 unspecified role unspecified role neutral component neutral component purified purified binding range binding range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 2.0 N/A 3943218 unspecified role unspecified role neutral component neutral component purified purified binding range binding range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false SF2B DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ losey-2006-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Losey HC., Ruthenburg AJ., Verdine GL. DIP original experiment: DIP-66176X Nature structural & molecular biology 2006 IMEx Crystal structure of Staphylococcus aureus tRNA adenosine deaminase TadA in complex with RNA. Losey HC., Ruthenburg AJ., Verdine GL. Only protein-protein interactions imex curation yamashita-2011-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yamashita K., Kawai Y., Tanaka Y., Hirano N., Kaneko J., Tomita N., Ohta M., Kamio Y., Yao M., Tanaka I. DIP original experiment: DIP-249708X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of the octameric pore of staphylococcal γ-hemolysin reveals the β-barrel pore formation mechanism by two components. Yamashita K., Kawai Y., Tanaka Y., Hirano N., Kaneko J., Tomita N., Ohta M., Kamio Y., Yao M., Tanaka I. Only protein-protein interactions imex curation yamashita-2011-2 in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Yamashita K., Kawai Y., Tanaka Y., Hirano N., Kaneko J., Tomita N., Ohta M., Kamio Y., Yao M., Tanaka I. DIP original experiment: DIP-249709X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of the octameric pore of staphylococcal γ-hemolysin reveals the β-barrel pore formation mechanism by two components. Yamashita K., Kawai Y., Tanaka Y., Hirano N., Kaneko J., Tomita N., Ohta M., Kamio Y., Yao M., Tanaka I. Only protein-protein interactions imex curation xiang-2008-6 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Xiang S., Tong L. DIP original experiment: DIP-113604X Nature structural & molecular biology 2008 IMEx Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction. Xiang S., Tong L. Only protein-protein interactions imex curation xiang-2008-7 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Xiang S., Tong L. DIP original experiment: DIP-113605X Nature structural & molecular biology 2008 IMEx Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction. Xiang S., Tong L. Only protein-protein interactions imex curation xiang-2008-9 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Xiang S., Tong L. DIP original experiment: DIP-113606X Nature structural & molecular biology 2008 IMEx Crystal structures of human and Staphylococcus aureus pyruvate carboxylase and molecular insights into the carboxyltransfer reaction. Xiang S., Tong L. Only protein-protein interactions imex curation dawson-2006-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dawson RJ., Locher KP. DIP original experiment: DIP-254010X Nature 2006 IMEx Structure of a bacterial multidrug ABC transporter. Dawson RJ., Locher KP. Only protein-protein interactions imex curation khusainov-2016-1 staa8 Staphylococcus aureus (strain NCTC 8325) 3d-em 3D electron microscopy 3D-EM electron tomog experimental particp experimental participant identification experimental particp Khusainov I., Vicens Q., Bochler A., Grosse F., Myasnikov A., Ménétret JF., Chicher J., Marzi S., Romby P., Yusupova G., Yusupov M., Hashem Y. marat@igbmc.fr Nucleic acids research 2016 Only protein-protein interactions imex curation imex curation lasso-2014-1 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Lasso G., Yu LP., Gil D., Lázaro M., Tong L., Valle M. DIP original experiment: DIP-261927X Structure (London, England : 1993) 2014 IMEx Functional conformations for pyruvate carboxylase during catalysis explored by cryoelectron microscopy. Lasso G., Yu LP., Gil D., Lázaro M., Tong L., Valle M. Only protein-protein interactions imex curation lasso-2010-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lasso G., Yu LP., Gil D., Xiang S., Tong L., Valle M. DIP original experiment: DIP-217185X Structure (London, England : 1993) 2010 IMEx Cryo-EM analysis reveals new insights into the mechanism of action of pyruvate carboxylase. Lasso G., Yu LP., Gil D., Xiang S., Tong L., Valle M. Only protein-protein interactions imex curation lasso-2010-2 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Lasso G., Yu LP., Gil D., Xiang S., Tong L., Valle M. DIP original experiment: DIP-217186X Structure (London, England : 1993) 2010 IMEx Cryo-EM analysis reveals new insights into the mechanism of action of pyruvate carboxylase. Lasso G., Yu LP., Gil D., Xiang S., Tong L., Valle M. Only protein-protein interactions imex curation yu-2009-18 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yu LP., Xiang S., Lasso G., Gil D., Valle M., Tong L. DIP original experiment: DIP-132041X Structure (London, England : 1993) 2009 IMEx A symmetrical tetramer for S. aureus pyruvate carboxylase in complex with coenzyme A. Yu LP., Xiang S., Lasso G., Gil D., Valle M., Tong L. Only protein-protein interactions imex curation yu-2009-19 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yu LP., Xiang S., Lasso G., Gil D., Valle M., Tong L. DIP original experiment: DIP-132042X Structure (London, England : 1993) 2009 IMEx A symmetrical tetramer for S. aureus pyruvate carboxylase in complex with coenzyme A. Yu LP., Xiang S., Lasso G., Gil D., Valle M., Tong L. Only protein-protein interactions imex curation yu-2009-20 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Yu LP., Xiang S., Lasso G., Gil D., Valle M., Tong L. DIP original experiment: DIP-132043X Structure (London, England : 1993) 2009 IMEx A symmetrical tetramer for S. aureus pyruvate carboxylase in complex with coenzyme A. Yu LP., Xiang S., Lasso G., Gil D., Valle M., Tong L. Only protein-protein interactions imex curation rs20_staa8 30S ribosomal protein S20 rpsT SAOUHSC_01689 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MANIKSAIKRVKTTEKAEARNISQKSAMRTAVKNAKTAVSNNADNKNELVSLAVKLVDKAAQSNLIHSNKADRIKSQLMTANK rl2_staa8 50S ribosomal protein L2 rplB SAOUHSC_02509 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MAIKKYKPITNGRRNMTSLDFAEITKTTPEKSLLKPLPKKAGRNNQGKLTVRHHGGGHKRQYRVIDFKRNKDGINAKVDSIQYDPNRSANIALVVYADGEKRYIIAPKGLEVGQIVESGAEADIKVGNALPLQNIPVGTVVHNIELKPGKGGQIARSAGASAQVLGKEGKYVLIRLRSGEVRMILSTCRATIGQVGNLQHELVNVGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAPIGRPSPMSPWGKPTLGKKTRRGKKSSDKLIVRGRKKK rs18_staa8 30S ribosomal protein S18 rpsR SAOUHSC_00350 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MAGGPRRGGRRRKKVCYFTANGITHIDYKDTELLKRFISERGKILPRRVTGTSAKYQRMLTTAIKRSRHMALLPYVKEEQ rs19_staa8 30S ribosomal protein S19 rpsS SAOUHSC_02508 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MARSIKKGPFVDEHLMKKVEAQEGSEKKQVIKTWSRRSTIFPNFIGHTFAVYDGRKHVPVYVTEDMVGHKLGEFAPTRTFKGHVADDKKTRR rl5_staa8 50S ribosomal protein L5 rplE SAOUHSC_02500 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MNRLKEKFNTEVTENLMKKFNYSSVMEVPKIDKIVVNMGVGDAVQNSKVLDNAVEELELITGQKPLVTKAKKSIATFRLREGMPIGAKVTLRGERMYEFLDKLISVSLPRVRDFQGVSKKAFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTANTDEEARELLANFGMPFRK rl6_staa8 50S ribosomal protein L6 rplF SAOUHSC_02496 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MSRVGKKIIDIPSDVTVTFDGNHVTVKGPKGELSRTLNERMTFKQEENTIEVVRPSDSKEDRTNHGTTRALLNNMVQGVSQGYVKVLELVGVGYRAQMQGKDLILNVGYSHPVEIKAEENITFSVEKNTVVKVEGISKEQVGALASNIRSVRPPEPYKGKGIRYQGEYVRRKEGKTGK rl3_staa8 50S ribosomal protein L3 rplC SAOUHSC_02512 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MTKGILGRKIGMTQVFGENGELIPVTVVEAKENVVLQKKTVEVDGYNAIQVGFEDKKAYKKDAKSNKYANKPAEGHAKKADAAPKRFIREFRNVDVDAYEVGQEVSVDTFVAGDVIDVTGVSKGKGFQGAIKRHGQSRGPMSHGSHFHRAPGSVGMASDASRVFKGQKMPGRMGGNTVTVQNLEVVQVDTENKVILVKGNVPGPKKGLVEIRTSIKKGNK rl4_staa8 50S ribosomal protein L4 rplD SAOUHSC_02511 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MANYDVLKLDGTKSGSIELSDAVFGIEPNNSVLFEAINLQRASLRQGTHAVKNRSAVSGGGRKPWKQKGTGRARQGTIRAPQWRGGGIVFGPTPRSYAYKMPKKMRRLALRSALSFKAQENGLTVVDAFNFEAPKTKEFKNVLSTLEQPKKVLVVTENEDVNVELSARNIPGVQVTTAQGLNVLDITNADSLVITEAAAKKVEEVLG rl15_staa8 50S ribosomal protein L15 rplO SAOUHSC_02492 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MKLHELKPAEGSRKERNRVGRGVATGNGKTSGRGHKGQKARSGGGVRPGFEGGQLPLFRRLPKRGFTNINRKEYAIVNLDQLNKFEDGTEVTPALLVESGVVKNEKSGIKILGNGSLDKKLTVKAHKFSASAAEAIDAKGGAHEVI rl16_staa8 50S ribosomal protein L16 rplP SAOUHSC_02505 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESARIAMTRYMKRGGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGRILFEVAGVSEEVAREALRLASHKLPVKTKFVKREELGGETNES rl13_staa8 50S ribosomal protein L13 rplM SAOUHSC_02478 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MRQTFMANESNIERKWYVIDAEGQTLGRLSSEVASILRGKNKVTYTPHVDTGDYVIVINASKIEFTGNKETDKVYYRHSNHPGGIKSITAGELRRTNPERLIENSIKGMLPSTRLGEKQGKKLFVYGGAEHPHAAQQPENYELRG rl14_staa8 50S ribosomal protein L14 rplN SAOUHSC_02502 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKNATPGGVVKKGDVVKAVIVRTKSGVRRNDGSYIKFDENACVIIRDDKGPRGTRIFGPVARELREGNFMKIVSLAPEVL rl19_staa8 50S ribosomal protein L19 rplS SAOUHSC_01211 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MTNHKLIEAVTKSQLRTDLPSFRPGDTLRVHVRIIEGTRERIQVFEGVVIKRRGGGVSETFTVRKISSGVGVERTFPLHTPKIEKIEVKRRGKVRRAKLYYLRSLRGKAARIQEIR rl20_staa8 50S ribosomal protein L20 rplT SAOUHSC_01784 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKLWITRINAAARQHEMSYSRLMNGLKKAGIDINRKMLSEIAISDEKAFAQLVTKAKDALK rl17_staa8 50S ribosomal protein L17 rplQ SAOUHSC_02484 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MGYRKLGRTSDQRKAMLRDLATSLIISERIETTEARAKEVRSVVEKLITLGKKGDLASRRNAAKTLRNVEILNEDETTQTALQKLFGEIAERYTERQGGYTRILKQGPRRGDGAESVIIELV rl18_staa8 50S ribosomal protein L18 rplR SAOUHSC_02495 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALAEAARESGLEF rl23_staa8 50S ribosomal protein L23 rplW SAOUHSC_02510 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MEARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVASVNIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDLFN rl24_staa8 50S ribosomal protein L24 rplX SAOUHSC_02501 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MHIKKGDNVKVIAGKDKGKEGKVIATLPKKDRVVVEGVNIMKKHQKPTQLNPEGGILETEAAIHVSNVQLLDPKTNEPTRVGYKFVDGKKVRIAKKSGEEIKSNN rl21_staa8 50S ribosomal protein L21 rplU SAOUHSC_01757 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVTATVNKQGRGKKITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA rl22_staa8 50S ribosomal protein L22 rplV SAOUHSC_02507 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKVLMSALANAEHNYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAKEA rl28_staa8 50S ribosomal protein L28 rpmB SAOUHSC_01191 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MGKQCFVTGRKASTGNRRSHALNSTKRRWNANLQKVRILVDGKPKKVWVSARALKSGKVTRV rl29_staa8 50S ribosomal protein L29 rpmC SAOUHSC_02504 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MKAKEIRDLTTSEIEEQIKSSKEELFNLRFQLATGQLEETARIRTVRKTIARLKTVAREREIEQSKANQ q2g0s0_staa8 50S ribosomal protein L25 General stress protein CTC rplY ctc SAOUHSC_00474 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MASLKSIIRQGKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKVIREVGRNGVIELGVGSKTIKVMVADYQFDPLKNQITHIDFLAINMSEERTVEVPVQLVGEAVGAKEGGVVEQPLFNLEVTATPDNIPEAIEVDITELNINDSLTVADVKVTGDFKIENDSAESVVTVVAPTEEPTEEEIEAMEGEQQTEEPEVVGESKEDEEKTEE rl27_staa8 50S ribosomal protein L27 rpmA SAOUHSC_01755 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MLKLNLQFFASKKGVSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGRGGDDTLFAKIDGVVKFERKGRDKKQVSVYAVAE rl32_staa8 50S ribosomal protein L32 rpmF SAOUHSC_01078 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MAVPKRRTSKTRKNKRRTHFKISVPGMTECPNCGREYKLSHRVCKNCGSYNGEEVAAK rl332_staa8 50S ribosomal protein L33 2 rpmG2 SAOUHSC_01651 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MRVNVTLACTECGDRNYITTKNKRNNPERVEMKKFCSRENKQTLHRETK rl30_staa8 50S ribosomal protein L30 rpmD SAOUHSC_02493 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MAKLQITLTRSVIGRPETQRKTVEALGLKKTNSSVVVEDNPAIRGQINKVKHLVTVEEK rl31b_staa8 50S ribosomal protein L31 type B rpmE2 SAOUHSC_02361 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTGRQKFAAADGRVERFNKKFGLKSNN rl36_staa8 50S ribosomal protein L36 rpmJ SAOUHSC_02488 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MKVRPSVKPICEKCKVIKRKGKVMVICENPKHKQRQG rl34_staa8 50S ribosomal protein L34 rpmH SAOUHSC_03055 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MVKRTYQPNKRKHSKVHGFRKRMSTKNGRKVLARRRRKGRKVLSA rl35_staa8 50S ribosomal protein L35 rpmI SAOUHSC_01785 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MPKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVSKSDMKRVKQLLAYKK rs4_staa8 30S ribosomal protein S4 rpsD SAOUHSC_01829 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MARFRGSNWKKSRRLGISLSGTGKELEKRPYAPGQHGPNQRKKLSEYGLQLREKQKLRYLYGMTERQFRNTFDIAGKKFGVHGENFMILLASRLDAVVYSLGLARTRRQARQLVNHGHILVDGKRVDIPSYSVKPGQTISVREKSQKLNIIVESVEINNFVPEYLNFDADSLTGTFVRLPERSELPAEINEQLIVEYYSR rs5_staa8 30S ribosomal protein S5 rpsE SAOUHSC_02494 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MARREEETKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTPINMVRATIDGLQNLKNAEDVAKLRGKTVEELYN rs2_staa8 30S ribosomal protein S2 rpsB SAOUHSC_01232 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MAVISMKQLLEAGVHFGHQTRRWNPKMKKYIFTERNGIYIIDLQKTVKKVDEAYNFLKQVSEDGGQVLFVGTKKQAQESVKSEAERAGQFYINQRWLGGLLTNYKTISKRIKRISEIEKMEEDGLFEVLPKKEVVELKKEYDRLIKFLGGIRDMKSMPQALFVVDPRKERNAIAEARKLNIPIVGIVDTNCDPDEIDYVIPANDDAIRAVKLLTAKMADAILEGQQGVSNEEVAAEQNIDLDEKEKSEETEATEE rs3_staa8 30S ribosomal protein S3 rpsC SAOUHSC_02506 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MGQKINPIGLRVGIIRDWEAKWYAEKDFASLLHEDLKIRKFIDNELKEASVSHVEIERAANRINIAIHTGKPGMVIGKGGSEIEKLRNKLNALTDKKVHINVIEIKKVDLDARLVAENIARQLENRASFRRVQKQAITRAMKLGAKGIKTQVSGRLGGADIARAEQYSEGTVPLHTLRADIDYAHAEADTTYGKLGVKVWIYRGEVLPTKNTSGGGK rs8_staa8 30S ribosomal protein S8 rpsH SAOUHSC_02498 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MTMTDPIADMLTRVRNANMVRHEKLELPASNIKKEIAEILKSEGFIKNVEYVEDDKQGVLRLFLKYGQNDERVITGLKRISKPGLRVYAKASEMPKVLNGLGIALVSTSEGVITDKEARKRNVGGEIIAYVW rs9_staa8 30S ribosomal protein S9 rpsI SAOUHSC_02477 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MTLAQVEYRGTGRRKNSVARVRLVPGEGNITVNNRDVREYLPFESLILDLNQPFDVTETKGNYDVLVNVHGGGFTGQAQAIRHGIARALLEADPEYRGSLKRAGLLTRDPRMKERKKPGLKAARRSPQFSKR rs6_staa8 30S ribosomal protein S6 rpsF SAOUHSC_00348 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MRTYEVMYIVRPNIEEDAKKALVERFNGILATEGAEVLEAKDWGKRRLAYEINDFKDGFYNIVRVKSDNNKATDEFQRLAKISDDIIRYMVIREDEDK rs7_staa8 30S ribosomal protein S7 rpsG SAOUHSC_00528 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MPRKGSVPKRDVLPDPIHNSKLVTKLINKIMLDGKRGTAQRILYSAFDLVEQRSGRDALEVFEEAINNIMPVLEVKARRVGGSNYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEDRLANEILDAANNTGGAVKKREDTHKMAEANKAFAHYRW rs12_staac 30S ribosomal protein S12 rpsL SACOL0591 protein protein staac Staphylococcus aureus (strain COL) MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRGVCTRVGTMTPRKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVRDLPGVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN rs13_staa8 30S ribosomal protein S13 rpsM SAOUHSC_02487 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MARIAGVDIPREKRVVISLTYIYGIGTSTAQKILEEANVSADTRVKDLTDDELGRIREVVDGYKVEGDLRRETNLNIKRLMEISSYRGIRHRRGLPVRGQKTKNNARTRKGPVKTVANKKK rs10_staam 30S ribosomal protein S10 rpsJ SAV2251 protein protein staam Staphylococcus aureus (strain Mu50 / ATCC 700699) MAKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAVHMYKDSREQFEQRTHKRLIDIVNPTPKTVDALMGLNLPSGVDIEIKL rs11_staa8 30S ribosomal protein S11 rpsK SAOUHSC_02486 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MARKQVSRKRRVKKNIENGVAHIRSTFNNTIVTITDEFGNALSWSSAGALGFKGSKKSTPFAAQMASETASKSAMEHGLKTVEVTVKGPGPGRESAIRALQSAGLEVTAIRDVTPVPHNGCRPPKRRRV rs16_staa8 30S ribosomal protein S16 rpsP SAOUHSC_01208 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MAVKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIKVDEALALKWLNDGAKPTDTVHNILSKEGIMKKFDEQKKAK rs17_staa8 30S ribosomal protein S17 rpsQ SAOUHSC_02503 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MSERNDRKVYVGKVVSDKMDKTITVLVETYKTHKLYGKRVKYSKKYKTHDENNSAKLGDIVKIQETRPLSATKRFRLVEIVEESVII rs14z_staa8 30S ribosomal protein S14 type Z rpsZ rpsN1 SAOUHSC_02499 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MAKTSMVAKQQKKQKYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKGQIPGVRKASW rs15_staa8 30S ribosomal protein S15 rpsO SAOUHSC_01250 protein protein staa8 Staphylococcus aureus (strain NCTC 8325) MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMVGRRRHLLNYLRSKDIQRYRELIKSLGIRR pyc_staam Pyruvate carboxylase pycA SAV1114 protein protein staam Staphylococcus aureus (strain Mu50 / ATCC 700699) MKQIKKLLVANRGEIAIRIFRAAAELDISTVAIYSNEDKSSLHRYKADESYLVGSDLGPAESYLNIERIIDVAKQANVDAIHPGYGFLSENEQFARRCAEEGIKFIGPHLEHLDMFGDKVKARTTAIKADLPVIPGTDGPIKSYELAKEFAEEAGFPLMIKATSGGGGKGMRIVREESELEDAFHRAKSEAEKSFGNSEVYIERYIDNPKHIEVQVIGDEHGNIVHLFERDCSVQRRHQKVVEVAPSVGLSPTLRQRICDAAIQLMENIKYVNAGTVEFLVSGDEFFFIEVNPRVQVEHTITEMVTGIDIVKTQILVAAGADLFGEEINMPQQKDITTLGYAIQCRITTEDPLNDFMPDTGTIIAYRSSGGFGVRLDAGDGFQGAEISPYYDSLLVKLSTHAISFKQAEEKMVRSLREMRIRGVKTNIPFLINVMKNKKFTSGDYTTKFIEETPELFDIQPSLDRGTKTLEYIGNVTINGFPNVEKRPKPDYELASIPTVSSSKIASFSGTKQLLDEVGPKGVAEWVKKQDDVLLTDTTFRDAHQSLLATRVRTKDMINIASKTADVFKDGFSLEMWGGATFDVAYNFLKENPWERLERLRKAIPNVLFQMLLRASNAVGYKNYPDNVIHKFVQESAKAGIDVFRIFDSLNWVDQMKVANEAVQEAGKISEGTICYTGDILNPERSNIYTLEYYVKLAKELEREGFHILAIKDMAGLLKPKAAYELIGELKSAVDLPIHLHTHDTSGNGLLTYKQAIDAGVDIIDTAVASMSGLTSQPSANSLYYALNGFPRHLRTDIEGMESLSHYWSTVRTYYSDFESDIKSPNTEIYQHEMPGGQYSNLSQQAKSLGLGERFDEVKDMYRRVNFLFGDIVKVTPSSKVVGDMALYMVQNDLDEQSVITDGYKLDFPESVVSFFKGEIGQPVNGFNKDLQAVILKGQEALTARPGEYLEPVDFEKVRELLEEEQQGPVTEQDIISYVLYPKVYEQYIQTRNQYGNLSLLDTPTFFFGMRNGETVEIEIDKGKRLIIKLETISEPDENGNRTIYYAMNGQARRIYIKDENVHTNANVKPKADKSNPSHIGAQMPGSVTEVKVSVGETVKANQPLLITEAMKMETTIQAPFDGVIKQVTVNNGDTIATGDLLIEIEKATD hlga_staam Gamma-hemolysin component A hlgA hlg2 SAV2419 H-gamma-2 H-gamma-II protein protein staam Staphylococcus aureus (strain Mu50 / ATCC 700699) MIKNKILTATLAVGLIAPLANPFIEISKAENKIEDIGQGAEIIKRTQDITSKRLAITQNIQFDFVKDKKYNKDALVVKMQGFISSRTTYSDLKKYPYIKRMIWPFQYNISLKTKDSNVDLINYLPKNKIDSADVSQKLGYNIGGNFQSAPSIGGSGSFNYSKTISYNQKNYVTEVESQNSKGVKWGVKANSFVTPNGQVSAYDQYLFAQDPTGPAARDYFVPDNQLPPLIQSGFNPSFITTLSHERGKGDKSEFEITYGRNMDATYAYVTRHRLAVDRKHDAFKNRNVTVKYEVNWKTHEVKIKSITPK a0a0h3jx61_staam hlgB SAV2421 protein protein staam Staphylococcus aureus (strain Mu50 / ATCC 700699) MKMNKLVKSSVATSMALLLLSGTANAEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQICWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK y1866_staam Putative multidrug export ATP-binding/permease protein SAV1866 SAV1866 protein protein staam Staphylococcus aureus (strain Mu50 / ATCC 700699) MIKRYLQFVKPYKYRIFATIIVGIIKFGIPMLIPLLIKYAIDGVINNHALTTDEKVHHLTIAIGIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQVISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYVFFGRLRKLTRERSQALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKHTRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVASFTTLTQSFASMDRVFQLIDEDYDIKNGVGAQPIEIKQGRIDIDHVSFQYNDNEAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLVQQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTITHADKIVVIENGHIVETGTHRELIAKQGAYEHLYSIQNL tada_staam tRNA-specific adenosine deaminase tadA SAV0558 protein protein staam Staphylococcus aureus (strain Mu50 / ATCC 700699) MTNDIYFMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTAHAEHIAIERAAKVLGSWRLEGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFNHRAIVDKGVLKEACSTLLTTFFKNLRANKKSTN tada-1 3140590 N/A 3140591 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction false false false hlga-lukf-1 3294466 N/A 3294468 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3294469 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false hlga-lukf-2 3294467 N/A 3294468 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3294469 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false spc-1 3293903 N/A 3293909 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false spc-2 3293904 N/A 3293909 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false spc-3 3293906 N/A 3293909 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false y1866_staam-1 3147567 N/A 3147568 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false rplb-rplc-22 4046880 N/A 4046881 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046882 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046883 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046884 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046885 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046886 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046887 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046888 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046889 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046890 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046891 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046892 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046893 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046894 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046895 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046896 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046897 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046898 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046899 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046900 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046901 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046902 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046903 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046904 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046905 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046906 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046907 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046908 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046909 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046910 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046911 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046912 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046913 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046914 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046915 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046916 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046917 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046918 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046919 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046920 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046921 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046922 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046923 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046924 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046925 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046926 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 N/A 4046927 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.0 physical association physical association false false false Table 1 sapc-1 3266753 N/A 3293909 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sapc-5 3293935 N/A 3293909 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sapc-6 3293936 N/A 3293909 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sapc-2 3293925 N/A 3293909 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sapc-3 3293926 N/A 3293909 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sapc-4 3293927 N/A 3293909 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false