MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint schlossmach-2011-1 Silintaphin-1--interaction with silicatein during structure-guiding bio-silica formation. in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Schlossmacher U., Wiens M., Schröder HC., Wang X., Jochum KP., Müller WE. FEBS J. (1742-464X) 2011 m_ller-2013-1 The silicatein propeptide acts as inhibitor/modulator of self-organization during spicule axial filament formation. in vitro In vitro tem transmission electron microscopy tem experimental particp experimental participant identification experimental particp Müller WE., Schröder HC., Muth S., Gietzen S., Korzhev M., Grebenjuk VA., Wiens M., Schloßmacher U., Wang X. wmueller@uni-mainz.de FEBS J. (1742-464X) 2013 b6gva0_subdo siltap protein protein sponge Suberites domuncula MSSEETPVEQPTAEETPASTEETPAETPATTETTEPAADDQPAVTEVTEVTETPAEPTPEATTEEPKAEEKKEEVKQKPKKEPKPAPDYRTTKSGWVQKQGLLFKKWQRQFMTLDEEDSVLRWWKSEQRTGSDGALYMKFCVGVSDPKAETTTTWPDDTADRCFVVCSPYRAFFLVAESQEDKNDWIQKLSAAKDKHNTEGRKLITTALISVEGIKASFDNGAADLDKTVKKEGIVEEKKTEELLQLDKTVKKEGIVEEKKTEEAAPTESETAPAEAEGAAAVTIEVEVETPAEEPPKEETPAEEPPKEETPAEVPPKEETPAEEPPKEETPAEEPPKEETPAEEPPKEETPAEDPPKEEETPAEEPPKDEAPAAAEGGEETKAED mint q2mev3_subdo silicaa-g protein protein sponge Suberites domuncula MLVTVVVLGLLGFASAAQPKFEFVEEWQLWKSTHSKMYESQLMELERHLTWLSNKKYIEQHNVNSHIFGFTLAMNQFGDLSELEYADYLGQYRIEDKKSGNYSKTFQRDPLQDYPEAVDWRTKGAVTAVKDQGDCGASYAFSAMGALEGANALAKGNAVSLSEQNIIDCSIPYGNHGCHGGNMYDAFLYVIANEGVDQDSAYPFVGKQSSCNYNSKYKGTSMSGMVSIKSGSESDLQAAVSNVGPVSVAIDGANSAFRFYYSGVYDSSRCSSSSLNHAMVVTGYGSYNGKKYWLAKNSWGTNWGNSGYVMMARNKYNQCGIATDASYPTL mint silicaa-g 1013663 q2mev3_subdo silicatein-α 1013664 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false mint f4a f4b f4c f4d f4e f4f silicaa_g-siltap 1013663 b6gva0_subdo silintaphin-1 1013665 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.4 q2mev3_subdo silicatein-α 1013664 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.1 direct interaction direct interaction false false false mint f4g f4h f4i f4j f4k f4l f4m silicaa_g-silicaa_g 1363897 q2mev3_subdo alpha-silicatein 1013664 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false q2mev3_subdo alpha-silicatein 1013664 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f6 mint