DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ song-2009-2 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Song J., Win J., Tian M., Schornack S., Kaschani F., Ilyas M., van der Hoorn RA., Kamoun S. DIP original experiment: DIP-133704X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Apoplastic effectors secreted by two unrelated eukaryotic plant pathogens target the tomato defense protease Rcr3. Song J., Win J., Tian M., Schornack S., Kaschani F., Ilyas M., van der Hoorn RA., Kamoun S. Only protein-protein interactions imex curation song-2009-3 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Song J., Win J., Tian M., Schornack S., Kaschani F., Ilyas M., van der Hoorn RA., Kamoun S. DIP original experiment: DIP-133702X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Apoplastic effectors secreted by two unrelated eukaryotic plant pathogens target the tomato defense protease Rcr3. Song J., Win J., Tian M., Schornack S., Kaschani F., Ilyas M., van der Hoorn RA., Kamoun S. Only protein-protein interactions imex curation song-2009-4 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Song J., Win J., Tian M., Schornack S., Kaschani F., Ilyas M., van der Hoorn RA., Kamoun S. DIP original experiment: DIP-133703X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Apoplastic effectors secreted by two unrelated eukaryotic plant pathogens target the tomato defense protease Rcr3. Song J., Win J., Tian M., Schornack S., Kaschani F., Ilyas M., van der Hoorn RA., Kamoun S. Only protein-protein interactions imex curation rosebrock-2007-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rosebrock TR., Zeng L., Brady JJ., Abramovitch RB., Xiao F., Martin GB. DIP original experiment: DIP-253181X Nature 2007 IMEx A bacterial E3 ubiquitin ligase targets a host protein kinase to disrupt plant immunity. Rosebrock TR., Zeng L., Brady JJ., Abramovitch RB., Xiao F., Martin GB. Only protein-protein interactions imex curation rosebrock-2007-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rosebrock TR., Zeng L., Brady JJ., Abramovitch RB., Xiao F., Martin GB. DIP original experiment: DIP-253179X Nature 2007 IMEx A bacterial E3 ubiquitin ligase targets a host protein kinase to disrupt plant immunity. Rosebrock TR., Zeng L., Brady JJ., Abramovitch RB., Xiao F., Martin GB. Only protein-protein interactions imex curation rosebrock-2007-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rosebrock TR., Zeng L., Brady JJ., Abramovitch RB., Xiao F., Martin GB. DIP original experiment: DIP-253180X Nature 2007 IMEx A bacterial E3 ubiquitin ligase targets a host protein kinase to disrupt plant immunity. Rosebrock TR., Zeng L., Brady JJ., Abramovitch RB., Xiao F., Martin GB. Only protein-protein interactions imex curation xing-2007-1 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. DIP original experiment: DIP-253115X Nature 2007 IMEx The structural basis for activation of plant immunity by bacterial effector protein AvrPto. Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. Only protein-protein interactions imex curation xing-2007-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. DIP original experiment: DIP-253111X Nature 2007 IMEx The structural basis for activation of plant immunity by bacterial effector protein AvrPto. Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. Only protein-protein interactions imex curation xing-2007-3 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. DIP original experiment: DIP-253117X Nature 2007 IMEx The structural basis for activation of plant immunity by bacterial effector protein AvrPto. Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. Only protein-protein interactions imex curation xing-2007-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. DIP original experiment: DIP-253114X Nature 2007 IMEx The structural basis for activation of plant immunity by bacterial effector protein AvrPto. Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. Only protein-protein interactions imex curation xing-2007-5 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. DIP original experiment: DIP-253118X Nature 2007 IMEx The structural basis for activation of plant immunity by bacterial effector protein AvrPto. Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. Only protein-protein interactions imex curation xing-2007-6 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. DIP original experiment: DIP-253112X Nature 2007 IMEx The structural basis for activation of plant immunity by bacterial effector protein AvrPto. Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. Only protein-protein interactions imex curation xing-2007-7 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. DIP original experiment: DIP-253116X Nature 2007 IMEx The structural basis for activation of plant immunity by bacterial effector protein AvrPto. Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. Only protein-protein interactions imex curation xing-2007-8 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. DIP original experiment: DIP-253113X Nature 2007 IMEx The structural basis for activation of plant immunity by bacterial effector protein AvrPto. Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. Only protein-protein interactions imex curation epic1_phyin Cystatin-like cysteine protease inhibitor EPIC1 EPIC1 Extracellular protease inhibitor with cystatin-like domain protein 1 Secreted effector EPIC1 protein protein phyin Phytophthora infestans Potato late blight fungus Botrytis infestans MTFLRPILALLAATALVTTSAQVDGGYSKKEVTPEDMELLQKAQSNVSAYNSDVTSRICYLKVDSLETQVVSGENYKFHVSGCSVNSDNELGGCANQNCESSKYDIVIYSQSWTNTLEVTSITPVK q8s335_solpi Rcr3 protein protein solpi Solanum pimpinellifolium Currant tomato Lycopersicon pimpinellifolium MAMKVDLMNILITLFFVISMFNTQTRGRSQPKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSYKLGMNEFADITSQEFLAKFTGLNIPNSYLSPSPMSSTEFKINDLSDDYMPSNLDWRESGAVTQVKHQGRCGCCWAFSAVGSLEGAYKIATGNLMEFSEQELLDCTTNNYGCNGGLMTNAFDFIIENGGISRESDYEYLGEQYTCRSREKTAAVQISSYKVVPEGETSLLQAVTKQPVSIGIAASQDLQFYAGGTYDGNCADQINHAVTAIGYGTDEEGQKYWLLKNSWGTSWGENGFMKIIRDSGDPSGLCDIAKMSSYPNIA q8nid8_pasfu avr2 protein protein pasfu Passalora fulva Tomato leaf mold Cladosporium fulvum MKLFILTFIWLLTASEVIAAAKKLPGCDKDPCKVKEKSGKYKLKIGAKCSATCDGKLTRGGTCENVQGNHLCCFGLCG epi2b_phyin Cystatin-like cysteine protease inhibitor EPIC2B EPIC2B Extracellular protease inhibitor with cystatin-like domain protein 2B Secreted effector EPIC2B protein protein phyin Phytophthora infestans Potato late blight fungus Botrytis infestans MSFLRPTLALLAVTALVTTSGQLNGYSKKEVTPEDTELLQKAQSNVSAYNSDVTSRICYLKVDSLETQVVSGENYKFHVSGCSVNSDKELGGCANQNCESSKYDIVIYSQSWTNTLKVTSITPAN q9lld3_solpi protein protein solpi Solanum pimpinellifolium Currant tomato Lycopersicon pimpinellifolium MGSKYSKATNSISDASNSRYGVPFENYRVPLVDLEEATNNFDDNFFIAEGGFGKVYRGVLRDGTKVALKRHNCDSQQSIEEFRTEIEILSRRSHPHLVSLIGYCDGRNEMILIYDYMENGNLKSHLYGSDLPSMSWEQRLEICIGAARGLHYLHTNGVMHRDVKSSNILLDENFVPKITDFGLSKTRPQLYQTHVSTDVKGTFGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPSEMVNLAEWAVESHNNGQLEQIIDPNLAAKIRPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYALRLQESVI hpab2_psesm Effector protein HopAB2 hopAB2 avrPtoB PSPTO_3087 Avirulence protein AvrPtoB protein protein psesm Pseudomonas syringae pv. tomato (strain DC3000) MAGINRAGPSGAYFVGHTDPEPVSGQAHGSGSGASSSNSPQVQPRPSNTPPSNAPAPPPTGRERLSRSTALSRQTREWLEQGMPTAEDASVRRRPQVTADAATPRAEARRTPEATADASAPRRGAVAHANSIVQQLVSEGADISHTRNMLRNAMNGDAVAFSRVEQNIFRQHFPNMPMHGISRDSELAIELRGALRRAVHQQAASAPVRSPTPTPASPAASSSGSSQRSLFGRFARLMAPNQGRSSNTAASQTPVDRSPPRVNQRPIRVDRAAMRNRGNDEADAALRGLVQQGVNLEHLRTALERHVMQRLPIPLDIGSALQNVGINPSIDLGESLVQHPLLNLNVALNRMLGLRPSAERAPRPAVPVAPATASRRPDGTRATRLRVMPEREDYENNVAYGVRLLNLNPGVGVRQAVAAFVTDRAERPAVVANIRAALDPIASQFSQLRTISKADAESEELGFKDAADHHTDDVTHCLFGGELSLSNPDQQVIGLAGNPTDTSQPYSQEGNKDLAFMDMKKLAQFLAGKPEHPMTRETLNAENIAKYAFRIVP q40126_solpi Fen protein protein solpi Solanum pimpinellifolium Currant tomato Lycopersicon pimpinellifolium MGSKYSKATNSINDASNLSYGVPFENYRVPFVDLEEATNNFDDNFFIGEGGFGKVYRGVLRDGTKVALKKHKPESSQGIEEFETEIEILSFCSHPHLVSLIGFCDERNEMILIYDYMENGNLKSHLYGSDLPSMSWEQRLEICIGAARGLHYLHKNAVIHRDVKCTNILLDENFVPKITDFGISKTMPELDQTHLSTVVRGNIGYIAPEYALWGQLTEKSDVYSFGVVLFEVLCARPALDRSEIMSLDDETQKMGQLEQIVDPTIAAKIRPESLRMFGETAIKCLAPSSKNRPSMGDVLWKLEYALCLQEPTIQDDPE q40234_solpi Pto protein protein solpi Solanum pimpinellifolium Currant tomato Lycopersicon pimpinellifolium MGSKYSKATNSINDALSSSYLVPFESYRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFCRHPHLVSLIGFCDERNEMILIYKYMENGNLKRHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAIIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVKGTLGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGDTAVKCLALSSEDRPSMGDVLWKLEYALRLQESVI mint pti1_sollc Pto-interacting protein 1 Pto kinase interactor 1 PTI1 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MSCFSCCDDDDMHRATDNGPFMAHNSAGNNGGQRATESAQRETQTVNIQPIAVPSIAVDELKDITDNFGSKALIGEGSYGRVYHGVLKSGRAAAIKKLDSSKQPDREFLAQVSMVSRLKDENVVELLGYCVDGGFRVLAYEYAPNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHIIHRDIKSSNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVKQCVDARLNTDYPPKAIAKMAAVAALCVQYEADFRPNMSIVVKALQPLLPRPVPS mint q08242_psesx EIZ61_05000 avrP protein protein psesx Pseudomonas syringae MGNICVGGSRMAHQVNSPDRVSNNSGDEDNVTSSQLLSVRHQLAESAGLPRDQHEFVSSQAPQSLRNRYNNLYSHTQRTLDMADMQHRYMTGASGINPGMLPHENVDDMRSAITDWSDMREALQHAMGIHADIPPSPERFVATMNPSGSIRMSTLSPSPYRNWQ a1l015_phyin-rcr3-1 3183332 N/A 3183335 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3183336 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana physical association physical association false false false avr2-rcr3-1 3183333 N/A 3183336 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana N/A 3183337 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false a1l017_phyin-rcr3-1 3183334 N/A 3183338 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3183336 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana physical association physical association false false false hopab2-q9lld3_solpi-1 3158976 N/A 3158979 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3158980 unspecified role unspecified role bait bait Region 1-307 Region 1-307 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q8RSY1:p.[Phe479Ala;Phe525Ala;Pro533Ala] F479A/F525A/P533A mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q8RSY1:p.[Lys512Arg;Lys520Arg;Lys521Arg;Lys529Arg] K512R/K520R/K521R/K529R mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false hopab2-fen-1 3158977 N/A 3158981 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3158980 unspecified role unspecified role bait bait Region 1-387 Region 1-387 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q8RSY1:p.[Phe479Ala;Phe525Ala;Pro533Ala] F479A/F525A/P533A mutation increasing strength mutation increasing interaction strength mutation increasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q8RSY1:p.[Lys512Arg;Lys520Arg;Lys521Arg;Lys529Arg] K512R/K520R/K521R/K529R mutation increasing strength mutation increasing interaction strength mutation increasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false hopab2-pto-1 3158978 N/A 3158982 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3158980 unspecified role unspecified role bait bait Region 1-307 Region 1-307 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false pti1-pto-1 3159701 N/A 3159709 enzyme target enzyme target substrate substrate unspecified role unspecified role Q41328:p.Lys96Gln K96Q mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3158982 enzyme enzyme unspecified role unspecified role Q40234:p.Thr199Ala T199A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false avrp-pto-1 3159702 N/A 3158982 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3159711 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false avrp-pto-2 3159703 N/A 3158982 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3159711 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false avrp-pto-3 3159704 N/A 3158982 unspecified role unspecified role unspecified role unspecified role Q40234:p.[His49Glu;Val51Gly] H49E/V51G mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q40234:p.[His49Glu;Val51Gly;Thr204Asn] H49E/V51G/T204N mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q40234:p.Thr204Asn T204N mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q40234:p.[His49Glu;Val51Gly;Ile160Phe] H49E/V51G/I160F mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q40234:p.Ser226Asp S226D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q40234:p.Thr199Ala T199A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q40234:p.Leu205Asp L205D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q40234:p.Arg163Ala R163A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3159711 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false pto-1 3159705 N/A 3158982 putative self putative self unspecified role unspecified role Q40234:p.Thr199Ala T199A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q40234:p.Arg163Ala R163A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q40234:p.Asp164Asn D164N mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q40234:p.Leu205Asp L205D mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q40234:p.Val201Asp V201D mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q40234:p.Thr204Asn T204N mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q40234:p.Ser226Asp S226D mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q40234:p.Lys202Asp K202D mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q40234:p.Gly203Asp G203D mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q40234:p.Gly206Asp G206D mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q40234:p.Tyr207Asp Y207D mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q40234:p.Ile208Asp I208D mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false avrp-pto-4 3159706 N/A 3158982 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3159711 unspecified role unspecified role unspecified role unspecified role Region 29-131 Region 29-131 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false avrp-pto-5 3159707 N/A 3158982 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3159711 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false pto-avrp-1 3159708 N/A 3158982 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3159711 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint nekrasov-2006-1 CITRX thioredoxin is a putative adaptor protein connecting Cf-9 and the ACIK1 protein kinase during the Cf-9/Avr9- induced defence response. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nekrasov V., Ludwig AA., Jones JD. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation nekrasov-2006-4 CITRX thioredoxin is a putative adaptor protein connecting Cf-9 and the ACIK1 protein kinase during the Cf-9/Avr9- induced defence response. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Nekrasov V., Ludwig AA., Jones JD. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation nekrasov-2006-3 CITRX thioredoxin is a putative adaptor protein connecting Cf-9 and the ACIK1 protein kinase during the Cf-9/Avr9- induced defence response. yeast Saccharomyces cerevisiae Baker's yeast protein three hybrid protein three hybrid trihybrid bridge assay protein 3-hybrid protein tri hybrid trihybrid bridge assay predetermined predetermined participant predetermined Nekrasov V., Ludwig AA., Jones JD. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation citx2_nicbe Thioredoxin-like protein CITRX2, chloroplastic CITRX2 Cf-9-interacting thioredoxin 2 protein protein nicbe Nicotiana benthamiana MQAATLSFQPSAPPLQTSAFHFSSKQPNQLKYSLFSYTCPILKRSLLSTQTLSRKSICKPPDVATGKYVREDYLVKKVSAKDIQELIKGERNVPLIIDFYATWCGPCILMAQELEMLAVEYESNALIVKVDTDDEYEFARDMQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDIINNDL mint pti1_sollc Pto-interacting protein 1 Pto kinase interactor 1 PTI1 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MSCFSCCDDDDMHRATDNGPFMAHNSAGNNGGQRATESAQRETQTVNIQPIAVPSIAVDELKDITDNFGSKALIGEGSYGRVYHGVLKSGRAAAIKKLDSSKQPDREFLAQVSMVSRLKDENVVELLGYCVDGGFRVLAYEYAPNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHIIHRDIKSSNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVKQCVDARLNTDYPPKAIAKMAAVAALCVQYEADFRPNMSIVVKALQPLLPRPVPS mint q40234_solpi Pto protein protein solpi Solanum pimpinellifolium Currant tomato Lycopersicon pimpinellifolium MGSKYSKATNSINDALSSSYLVPFESYRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFCRHPHLVSLIGFCDERNEMILIYKYMENGNLKRHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAIIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVKGTLGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGDTAVKCLALSSEDRPSMGDVLWKLEYALRLQESVI mint cf9_solpi Receptor-like protein Cf-9 CF-9 protein protein solpi Solanum pimpinellifolium Currant tomato Lycopersicon pimpinellifolium MDCVKLVFLMLYTFLCQLALSSSLPHLCPEDQALSLLQFKNMFTINPNASDYCYDIRTYVDIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSFNNFTGSLISPKFGEFSNLTHLDLSHSSFTGLIPSEICHLSKLHVLRICDQYGLSLVPYNFELLLKNLTQLRELNLESVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSNLQSLHLSVNPQLTVRFPTTKWNSSASLMTLYVDSVNIADRIPKSFSHLTSLHELYMGRCNLSGPIPKPLWNLTNIVFLHLGDNHLEGPISHFTIFEKLKRLSLVNNNFDGGLEFLSFNTQLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFSGKIQEFKSKTLSAVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSKNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCGGEDQVTTPAELDQEEEEEDSPMISWQGVLVGYGCGLVIGLSVIYIMWSTQYPAWFSRMDLKLEHIITTKMKKHKKRY mint q84qd9_tobac ACIK1 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MKITWESLVPSCFKGENPKPKAKEIKVVTKQSSFHRISISDFSASTISEDLSISLAGSNLYIFTLQELKVITQNFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGTQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLAYEYMPRGSLENQLFRRYSVSLPWSTRMKIAVGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYSAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYLMTGHLTAASDVYSFGVVLLELLTGRRSVDKTRPNREQNLVDWARPQLKDPRKLRRIMDPRLEGLYSEEGAQKAALVAYQCLSHRPKARPEMSSVVKTLEPLKDYKDISNMIFVYIAPAEVKEMCKESEKEDQKKTIKKENSPYHQKHHHHHLDRKHRRSPQNSTIYSEKALHKKLGPNSPLRNDFHRA mint citrx2-acik1 501763 q6je37_nicbe 501767 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q84qd9_tobac 501768 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F1B F1D mint acik1-citrx2 501763 q84qd9_tobac 501768 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q6je37_nicbe 501767 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F1C mint cf_9-citrx2 501763 q40235_solpi 501769 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q6je37_nicbe 501767 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F1E mint acik1-citrx2-1 501764 q84qd9_tobac 501768 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q6je37_nicbe 501767 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F3 mint citrx2-pto 501764 q40234_solpi 501770 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q6je37_nicbe 501767 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F3 mint pti1-pto 501764 q40234_solpi 501770 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 pti1_sollc 501771 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate neutral component neutral component purified purified Q41328:p.Lys96Asp mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F3 mint cf_9-acik1 501766 q40235_solpi 501769 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q6je37_nicbe 501767 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 q84qd9_tobac 501768 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F1G mint