MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint oh-2013a-1 Two leucines in the N-terminal MAPK-docking site of tomato SlMKK2 are critical for interaction with a downstream MAPK to elicit programmed cell death associated with plant immunity. nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip experimental particp experimental participant identification experimental particp Oh CS., Hwang J., Choi MS., Kang BC., Martin GB. co35@khu.ac.kr FEBS Lett. (0014-5793) 2013 devarenne-2006-1 Adi3 is a Pdk1-interacting AGC kinase that negatively regulates plant cell death. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Devarenne TP., Ekengren SK., Pedley KF., Martin GB. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation devarenn-2006-1 Adi3 is a Pdk1-interacting AGC kinase that negatively regulates plant cell death. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Devarenne TP., Ekengren SK., Pedley KF., Martin GB. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation devarenn-2006-2 Adi3 is a Pdk1-interacting AGC kinase that negatively regulates plant cell death. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Devarenne TP., Ekengren SK., Pedley KF., Martin GB. EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation nekrasov-2006-4 CITRX thioredoxin is a putative adaptor protein connecting Cf-9 and the ACIK1 protein kinase during the Cf-9/Avr9- induced defence response. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Nekrasov V., Ludwig AA., Jones JD. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation wen-2013-1 d-13-01010r1 in vitro In vitro enzymatic study enzymatic study experimental particp experimental participant identification experimental particp Wen S., Ma Q.M., Zhang Y.L., Yang J.P., Zhao G.H., Fu D.Q., Luo Y.B., Qu G.Q. FEBS Lett. (0014-5793) 2013 imex curation Only protein-protein interactions 14337_sollc 14-3-3 protein 7 TFT7 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MEKEREKQVYLARLAEQAERYDEMVEAMKAIAKMDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEESKGHEQNVKRIKTYRQRVEDELTKICSDILSVIDEHLVPSSTTGESTVFYYKMKGDYYRYLAEFKAGDDRKEASEQSLKAYEAATATASSDLAPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLSEESYKDSTLIMQLLRDNLTLWTSDLEEGGEHSKGDERQGEN mint q66mh7_sollc 543947 LeMKK3 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MKTAKPLKQLKLSVPAQDTPISSFLTASGTFHDGDLLLNQKGLRLISEENESLPSETKEIDLQFSLEDLETIKVIGKGSGGVVQLVRHKWVGTLFALKVIQMNIQEDIRKQIVQELKINQASQCPHVVVCYHSFYHNGAISLVLEYMDRGSLVDVIGQLKTILEPYLAVVCKQVLQGLVYLHHERHVIHRDIKPSNLLVNHKGEVKITDFGVSAMLASSMGQRDTFVGTYNYMAPERISGSTYDYKSDIWSLGMVILECAIGRFPYIQSEDQQARPSFYELLDAIVSSPPPSAPVDQFSPEFCSFVSACIQKDPRDRSSALDLLSHPFVKKFEDKDIDLSILVSSLEPPVNFPR mint q66mh8_sollc LeMKK2 MAPKK5 MKK5 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MRPAANSTNAASSMPPPSSAGQRSRPRRRTDLTLPLPQRDVALAVPLPLPPTSSSSSSSPLPTPLHFSELERVNRIGSGTGGTVYKVLHRPTGRLYALKVIYGNHEDSVRLQMCREIEILRDVDNPNVVRCHDMFDHNGEIQVLLEFMDKGSLEGIHIPLEQPLSDLTRQVLSGLYYLHRRKIVHRDIKPSNLLINSRREVKIADFGVSRVLAQTMDPCNSSVGTIAYMSPERINTDLNHGQYDGYAGDIWSLGVSILEFYLGRFPFSVGRQGDWASLMCAICMSQPPEAPPSASREFREFIACCLQRDPARRWTAGQLLRHPFITQNSTGTTHTGPATTTTSLSHPLLPPPPHFSSSS mint p93215_sollc pto 101268866 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MGSKYSKATNSISDASNSFESYRFPLEDLEEATNNFDDKFFIGEGAFGKVYKGVLRDGTKVALKRQNRDSRQGIEEFGTEIGILSRRSHPHLVSLIGYCDERNEMVLIYDYMENGNLKSHLTGSDLPSMSWEQRLEICIGAARGLHYLHTNGVMHRDVKSSNILLDENFVPKITDFGLSKTRPQLYQTTDVKGTFGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAMVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYALRLQESVI mint q5i6e9_sollc Adi3 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MERIPEVRESTRQFPIGAKVAHTFSTSKKEVGIRGFRDFDLAIPIQTWKGKTSYQEEEDLMVDAGTIKRSDDSLEDSGSTSFHGASHPPEPVDTDLMRPVYVPIGQNKADGKCLVKNVSLKGPFLDDLSIRMPNVKPSPSLLSPAESLVEEPNDLGVISSPFTVPRPSQNTETSLPPDSEEKECIWDASLPPSGNVSPLSSIDSTGVVRSMSIVNSCTSTYRSDVLMSDGMLSVDRNYESTKGSIRGDSLESGKTSLSRASDSSGLSDDSNWSNITGSANKPHKGNDPRWKAILAIRARDGILGMSHFKLLKRLGCGDIGSVYLSELSGTRCYFAMKVMDKASLASRKKLTRAQTEREILQLLDHPFLPTLYTHFETDRFSCLVMEYCPGGDLHTLRQRQPGKHFSEYAARFYAAEVLLALEYLHMLGVVYRDLKPENVLVRDDGHIMLSDFDLSLRCAVSPTLIRISSDDPSKRGAAFCVQPACIEPTTVCMQPACFLPRLFPQKSKKKTPKPRADSGFQANSMPELVAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLHELLYGKTPFKGSGNRATLFNVVGQQLKFPDSPATSYASRDLIRGLLVKEPQNRLGVKRGATEIKQHPFFEGVNWALIRCSTPPEVPRPVEPDYPAKYGQVNPVGVGNTSKRVVGADAKSGGKYLDFEFF q5i6e8_sollc Non-specific serine/threonine protein kinase Pdk1 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MLALVGGEGDMEQEFDAKLKIQNNSANTQRSKSFAFRAPQENFTIQDFELGKIYGVGSYSKVVRAKKKDTANVYALKIMDKKFITKENKTAYVKLERIVLDQLDHPGVVRLFFTFQDTFSLYMALESCEGGELFDQITRKGRLSEDEARFYAAEVVDALEYIHSMGLIHRDIKPENLLLTSDGHIKIADFGSVKPMQDSRITVLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDASEWLIFQRIIARDIRFPNYFSNEARDIIDQLLDVDPSRRPGAGPDGYASLKNHPFFSGIDWENLRLQTPPRLAMEPKAPSTHSSGDEQDPSWNPSHIGDGSVRPNDGNGAAASVSEAGNSITRLASIDSFDSKWKQFLDPGESVLMISMVKKLQKLTSKKVQLILTNKPKLIYVDPSKLVIKGNIIWSDNPNDLSIQVTSPSQFKICTPKKVMSFEDAKNRAQQWKKAIEALQNR mint k4cwy6_sollc 543845 MCA protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MAKKAVLIGINYPGTKAELRGCINDVKRMYNCLLNRYGFAEEDITVLIDTDDSYTQPTGRNIRKALSDLVGSAESGDCLFVHYSGHGTRLPAETGEEDDTGFDECIVPCDMNLITDDDFRELVDKVPEGCQITIVSDSCHSGGLIDKAKEQIGESHKQGDDDEGHGSGFGFKNFLRRNVEDAFESRGIHLPGRHHRREEEEENFAESSVIETEDGDQVHVKSKSLPLSTLIEILKQKTGKDDIDVGKLRPTLFDVFGEDASPKVKKFMKIIFNKLQKNNEQGGGGGFMGMVGNLAQEFLKQKLDENDESYAKPAMETHVEGKQEVYAGSGNRGLPDSGILVSGCQTDQTSADATPAGGESYGALSNAIQEILAESDGPVTNEELVSKARKKMQKQGFTQRPGLYCDDHHVDAPFVC mint citx2_nicbe Thioredoxin-like protein CITRX2, chloroplastic CITRX2 Cf-9-interacting thioredoxin 2 protein protein nicbe Nicotiana benthamiana MQAATLSFQPSAPPLQTSAFHFSSKQPNQLKYSLFSYTCPILKRSLLSTQTLSRKSICKPPDVATGKYVREDYLVKKVSAKDIQELIKGERNVPLIIDFYATWCGPCILMAQELEMLAVEYESNALIVKVDTDDEYEFARDMQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDIINNDL mint pti1_sollc Pto-interacting protein 1 Pto kinase interactor 1 PTI1 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MSCFSCCDDDDMHRATDNGPFMAHNSAGNNGGQRATESAQRETQTVNIQPIAVPSIAVDELKDITDNFGSKALIGEGSYGRVYHGVLKSGRAAAIKKLDSSKQPDREFLAQVSMVSRLKDENVVELLGYCVDGGFRVLAYEYAPNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHIIHRDIKSSNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVKQCVDARLNTDYPPKAIAKMAAVAALCVQYEADFRPNMSIVVKALQPLLPRPVPS mint q40234_solpi Pto protein protein solpi Solanum pimpinellifolium Currant tomato Lycopersicon pimpinellifolium MGSKYSKATNSINDALSSSYLVPFESYRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFCRHPHLVSLIGFCDERNEMILIYKYMENGNLKRHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAIIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVKGTLGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGDTAVKCLALSSEDRPSMGDVLWKLEYALRLQESVI mint q84qd9_tobac ACIK1 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MKITWESLVPSCFKGENPKPKAKEIKVVTKQSSFHRISISDFSASTISEDLSISLAGSNLYIFTLQELKVITQNFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGTQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLAYEYMPRGSLENQLFRRYSVSLPWSTRMKIAVGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYSAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYLMTGHLTAASDVYSFGVVLLELLTGRRSVDKTRPNREQNLVDWARPQLKDPRKLRRIMDPRLEGLYSEEGAQKAALVAYQCLSHRPKARPEMSSVVKTLEPLKDYKDISNMIFVYIAPAEVKEMCKESEKEDQKKTIKKENSPYHQKHHHHHLDRKHRRSPQNSTIYSEKALHKKLGPNSPLRNDFHRA mint lemkk3-lemkk2 1377378 slmkk2 SlMKK2 1377379 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q66MH8:p.Arg28Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q66MH8:p.Leu34Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q66MH8:p.Leu32Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q66MH8:p.Arg29Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false slmkk3 SlMPK3 1377380 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1b f1c mint tft7-tft7 1377378 14337_sollc TFT7 1377381 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 14337_sollc TFT7 1377381 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2 domino mint lemkk3-lemkk2-1 1377378 slmkk3 SlMPK3 1377380 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false slmkk2 SlMKK2 1377379 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q66MH8:p.Arg28Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q66MH8:p.Leu32Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q66MH8:p.Arg29Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q66MH8:p.Leu34Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3 mint lemkk3-lemkk2-2 1377378 slmkk3 SlMPK3 1377380 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false slmkk2 SlMKK2 1377379 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q66MH8:p.Arg29Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q66MH8:p.Arg28Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f3 mint lemkk3-lemkk2-3 1377378 slmkk2 SlMKK2 1377379 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q66MH8:p.Leu34Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q66MH8:p.Leu32Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false slmkk3 SlMPK3 1377380 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3 mint adi3-pdk1 493464 q5i6e8_sollc 493467 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q5i6e9_sollc 493468 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate neutral component neutral component purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q5I6E9:p.Phe697Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F3B F2C F2E F2F mint adi3-adi3 493464 q5i6e9_sollc 493468 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme self self purified purified Q5I6E9:p.Glu698Ala mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q5I6E9:p.Phe697Ala mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q5I6E9:p.Phe700Ala mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 q5i6e9_sollc 493468 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate self self purified purified mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F1A F3D mint adi3-pto 493464 p93215_sollc 493469 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q5i6e9_sollc 493468 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate neutral component neutral component purified purified mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F1C mint pdk1-pdk1 493464 q5i6e8_sollc 493467 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme self self purified purified Q5I6E8:p.Lys77Gln mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q5i6e8_sollc 493467 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate self self purified purified mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F2A mint pdk1-adi3 493465 q5i6e8_sollc 493467 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q5i6e9_sollc 493468 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F2B mint pdk1-adi3-1 493466 q5i6e8_sollc 493467 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q5i6e9_sollc 493468 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false F3C F2D mint acik1-citrx2-1 501764 q84qd9_tobac 501768 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q6je37_nicbe 501767 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F3 mint citrx2-pto 501764 q40234_solpi 501770 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q6je37_nicbe 501767 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F3 mint pti1-pto 501764 q40234_solpi 501770 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 pti1_sollc 501771 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate neutral component neutral component purified purified Q41328:p.Lys96Asp mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F3 mint mca-1 1435437 n/a LeMCA1 1435438 anti tag western anti tag western blot anti tag western self self self self purified purified K4CWY6:p.Cys139Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cleavage cleavage reaction cleavage false true false mint f2a f3 f4b true mca-1 1435437 mca LeMCA1 1435438 anti tag western anti tag western blot anti tag western self self self self purified purified tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false K4CWY6:p.Lys223Gly mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false cleavage cleavage reaction cleavage false true false mint f2a f3 f4b true DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ abramovitch-2006-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Abramovitch RB., Janjusevic R., Stebbins CE., Martin GB. DIP original experiment: DIP-262593X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Type III effector AvrPtoB requires intrinsic E3 ubiquitin ligase activity to suppress plant cell death and immunity. Abramovitch RB., Janjusevic R., Stebbins CE., Martin GB. Only protein-protein interactions imex curation abramovitch-2006-2 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Abramovitch RB., Janjusevic R., Stebbins CE., Martin GB. DIP original experiment: DIP-262596X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Type III effector AvrPtoB requires intrinsic E3 ubiquitin ligase activity to suppress plant cell death and immunity. Abramovitch RB., Janjusevic R., Stebbins CE., Martin GB. Only protein-protein interactions imex curation abramovitch-2006-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Abramovitch RB., Janjusevic R., Stebbins CE., Martin GB. DIP original experiment: DIP-262594X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Type III effector AvrPtoB requires intrinsic E3 ubiquitin ligase activity to suppress plant cell death and immunity. Abramovitch RB., Janjusevic R., Stebbins CE., Martin GB. Only protein-protein interactions imex curation abramovitch-2006-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Abramovitch RB., Janjusevic R., Stebbins CE., Martin GB. DIP original experiment: DIP-262595X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Type III effector AvrPtoB requires intrinsic E3 ubiquitin ligase activity to suppress plant cell death and immunity. Abramovitch RB., Janjusevic R., Stebbins CE., Martin GB. Only protein-protein interactions imex curation gonzales_vigil-2011-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Gonzales-Vigil E., Bianchetti CM., Phillips GN., Howe GA. DIP original experiment: DIP-249218X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Adaptive evolution of threonine deaminase in plant defense against insect herbivores. Gonzales-Vigil E., Bianchetti CM., Phillips GN., Howe GA. Only protein-protein interactions imex curation gonzales_vigil-2011-2 sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gonzales-Vigil E., Bianchetti CM., Phillips GN., Howe GA. DIP original experiment: DIP-249219X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Adaptive evolution of threonine deaminase in plant defense against insect herbivores. Gonzales-Vigil E., Bianchetti CM., Phillips GN., Howe GA. Only protein-protein interactions imex curation ishibashi-2007-1 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ishibashi K., Masuda K., Naito S., Meshi T., Ishikawa M. DIP original experiment: DIP-113949X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx An inhibitor of viral RNA replication is encoded by a plant resistance gene. Ishibashi K., Masuda K., Naito S., Meshi T., Ishikawa M. Only protein-protein interactions imex curation katsir-2008-1 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Katsir L., Schilmiller AL., Staswick PE., He SY., Howe GA. DIP original experiment: DIP-110979X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx COI1 is a critical component of a receptor for jasmonate and the bacterial virulence factor coronatine. Katsir L., Schilmiller AL., Staswick PE., He SY., Howe GA. Only protein-protein interactions imex curation katsir-2008-2 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Katsir L., Schilmiller AL., Staswick PE., He SY., Howe GA. DIP original experiment: DIP-110980X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx COI1 is a critical component of a receptor for jasmonate and the bacterial virulence factor coronatine. Katsir L., Schilmiller AL., Staswick PE., He SY., Howe GA. Only protein-protein interactions imex curation breithaupt-2006-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Breithaupt C., Kurzbauer R., Lilie H., Schaller A., Strassner J., Huber R., Macheroux P., Clausen T. DIP original experiment: DIP-263852X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Crystal structure of 12-oxophytodienoate reductase 3 from tomato: self-inhibition by dimerization. Breithaupt C., Kurzbauer R., Lilie H., Schaller A., Strassner J., Huber R., Macheroux P., Clausen T. Only protein-protein interactions imex curation breithaupt-2006-2 ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Breithaupt C., Kurzbauer R., Lilie H., Schaller A., Strassner J., Huber R., Macheroux P., Clausen T. DIP original experiment: DIP-263853X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Crystal structure of 12-oxophytodienoate reductase 3 from tomato: self-inhibition by dimerization. Breithaupt C., Kurzbauer R., Lilie H., Schaller A., Strassner J., Huber R., Macheroux P., Clausen T. Only protein-protein interactions imex curation breithaupt-2006-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Breithaupt C., Kurzbauer R., Lilie H., Schaller A., Strassner J., Huber R., Macheroux P., Clausen T. DIP original experiment: DIP-263854X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Crystal structure of 12-oxophytodienoate reductase 3 from tomato: self-inhibition by dimerization. Breithaupt C., Kurzbauer R., Lilie H., Schaller A., Strassner J., Huber R., Macheroux P., Clausen T. Only protein-protein interactions imex curation breithaupt-2006-4 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Breithaupt C., Kurzbauer R., Lilie H., Schaller A., Strassner J., Huber R., Macheroux P., Clausen T. DIP original experiment: DIP-263855X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Crystal structure of 12-oxophytodienoate reductase 3 from tomato: self-inhibition by dimerization. Breithaupt C., Kurzbauer R., Lilie H., Schaller A., Strassner J., Huber R., Macheroux P., Clausen T. Only protein-protein interactions imex curation thines-2007-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Thines B., Katsir L., Melotto M., Niu Y., Mandaokar A., Liu G., Nomura K., He SY., Howe GA., Browse J. DIP original experiment: DIP-253150X Nature 2007 IMEx JAZ repressor proteins are targets of the SCF(COI1) complex during jasmonate signalling. Thines B., Katsir L., Melotto M., Niu Y., Mandaokar A., Liu G., Nomura K., He SY., Howe GA., Browse J. Only protein-protein interactions imex curation thines-2007-3 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Thines B., Katsir L., Melotto M., Niu Y., Mandaokar A., Liu G., Nomura K., He SY., Howe GA., Browse J. DIP original experiment: DIP-253152X Nature 2007 IMEx JAZ repressor proteins are targets of the SCF(COI1) complex during jasmonate signalling. Thines B., Katsir L., Melotto M., Niu Y., Mandaokar A., Liu G., Nomura K., He SY., Howe GA., Browse J. Only protein-protein interactions imex curation glick-2008-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Glick E., Zrachya A., Levy Y., Mett A., Gidoni D., Belausov E., Citovsky V., Gafni Y. DIP original experiment: DIP-68191X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction with host SGS3 is required for suppression of RNA silencing by tomato yellow leaf curl virus V2 protein. Glick E., Zrachya A., Levy Y., Mett A., Gidoni D., Belausov E., Citovsky V., Gafni Y. Only protein-protein interactions imex curation glick-2008-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Glick E., Zrachya A., Levy Y., Mett A., Gidoni D., Belausov E., Citovsky V., Gafni Y. DIP original experiment: DIP-68194X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction with host SGS3 is required for suppression of RNA silencing by tomato yellow leaf curl virus V2 protein. Glick E., Zrachya A., Levy Y., Mett A., Gidoni D., Belausov E., Citovsky V., Gafni Y. Only protein-protein interactions imex curation glick-2008-3 tobac Nicotiana tabacum (Common tobacco) Common tobacco fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Glick E., Zrachya A., Levy Y., Mett A., Gidoni D., Belausov E., Citovsky V., Gafni Y. DIP original experiment: DIP-68192X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Interaction with host SGS3 is required for suppression of RNA silencing by tomato yellow leaf curl virus V2 protein. Glick E., Zrachya A., Levy Y., Mett A., Gidoni D., Belausov E., Citovsky V., Gafni Y. Only protein-protein interactions imex curation xing-2007-1 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. DIP original experiment: DIP-253115X Nature 2007 IMEx The structural basis for activation of plant immunity by bacterial effector protein AvrPto. Xing W., Zou Y., Liu Q., Liu J., Luo X., Huang Q., Chen S., Zhu L., Bi R., Hao Q., Wu JW., Zhou JM., Chai J. Only protein-protein interactions imex curation ottmann-2009-1 sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ottmann C., Rose R., Huttenlocher F., Cedzich A., Hauske P., Kaiser M., Huber R., Schaller A. DIP original experiment: DIP-134575X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural basis for Ca2+-independence and activation by homodimerization of tomato subtilase 3. Ottmann C., Rose R., Huttenlocher F., Cedzich A., Hauske P., Kaiser M., Huber R., Schaller A. Only protein-protein interactions imex curation ottmann-2009-2 sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ottmann C., Rose R., Huttenlocher F., Cedzich A., Hauske P., Kaiser M., Huber R., Schaller A. DIP original experiment: DIP-134576X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural basis for Ca2+-independence and activation by homodimerization of tomato subtilase 3. Ottmann C., Rose R., Huttenlocher F., Cedzich A., Hauske P., Kaiser M., Huber R., Schaller A. Only protein-protein interactions imex curation ottmann-2009-3 nicbe Nicotiana benthamiana molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ottmann C., Rose R., Huttenlocher F., Cedzich A., Hauske P., Kaiser M., Huber R., Schaller A. DIP original experiment: DIP-134577X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structural basis for Ca2+-independence and activation by homodimerization of tomato subtilase 3. Ottmann C., Rose R., Huttenlocher F., Cedzich A., Hauske P., Kaiser M., Huber R., Schaller A. Only protein-protein interactions imex curation sbt3_sollc Subtilisin-like protease SBT3 sbt3 LeSBT3 SlSBT3 Subtilase 3 Solyc01g087850 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MELLHLLLFSWALSAHLFLALAQRSTYIVHLDKSLMPNVFTDHHHWHSSTIDSIKASVPSSVDRFHSAPKLVYSYDNVLHGFSAVLSKDELAALKKLPGFISAYKDRTVEPHTTHTSDFLKLNPSSGLWPASGLGQDVIVAVLDSGIWPESASFQDDGMPEIPKRWKGICKPGTQFNASMCNRKLIGANYFNKGILANDPTVNITMNSARDTDGHGTHCASITAGNFAKGVSHFGYAPGTARGVAPRARLAVYKFSFNEGTFTSDLIAAMDQAVADGVDMISISYGYRFIPLYEDAISIASFGAMMKGVLVSASAGNRGPGIGSLNNGSPWILCVASGHTDRTFAGTLTLGNGLKIRGWSLFPARAFVRDSPVIYNKTLSDCSSEELLSQVENPENTIVICDDNGDFSDQMRIITRARLKAAIFISEDPGVFRSATFPNPGVVVNKKEGKQVINYVKNSVTPTATITFQETYLDTKPAPVVAASSARGPSRSYLGISKPDILAPGVLILAAYPPNVFATSIGTNILLSTDYILESGTSMAAPHAAGIAAMLKAAHPEWSPSAIRSAMMTTADPLDNTRKPIKDSDNNKAATPLDMGAGHVDPNRALDPGLVYDATPQDYVNLLCSLNFTEEQFKTIARSSASHNCSNPSADLNYPSFIALYSIEGNFTLLEQKFKRTVTNVGKGAATYKAKLKAPKNSTISVSPQILVFKNKNEKQSYTLTIRYIGDEGQSRNVGSITWVEQNGNHSVRSPIVTSPIIEVW opr3_sollc 12-oxophytodienoate reductase 3 12-oxophytodienoate-10,11-reductase 3 LeOPR3 OPR3 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MASSAQDGNNPLFSPYKMGKFNLSHRVVLAPMTRCRALNNIPQAALGEYYEQRATAGGFLITEGTMISPTSAGFPHVPGIFTKEQVREWKKIVDVVHAKGAVIFCQLWHVGRASHEVYQPAGAAPISSTEKPISNRWRILMPDGTHGIYPKPRAIGTYEISQVVEDYRRSALNAIEAGFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFITQVVQAVVSAIGADRVGVRVSPAIDHLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPRYVAYGQTEAGRLGSEEEEARLMRTLRNAYQGTFICSGGYTRELGIEAVAQGDADLVSYGRLFISNPDLVMRIKLNAPLNKYNRKTFYTQDPVVGYTDYPFLQGNGSNGPLSRL sgs3_sollc Protein SUPPRESSOR OF GENE SILENCING 3 SGS3 SlSGS3 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MSFSKWGGKPSNSSEKQKASSTPTVEEINRGVGDIGLNSEQNEGWEVYARKPKNKGGSSAGKQWAPQNPSPKAWGNQNTKAWGHPDVGKKSGTRNNAGSGRGSGNNWSTPSDPQKLARPHLYDGGFPSSAPVPPALKNGWDWSSRVASAHPKDNSQVAAAADDDKASEHDAEDNELDFLDESDDDLHSDDFDSDVGEMSYETRKKNPWFNQLFHSLDSLTVTEINEPERQWHCPACKGGPGAIEWFTGLQSLMTHAKTKGLRVKIHRELAELLEEDLRQRGTSVVPPGEVYGRWGGMEFKDKEIVWPPMVIIMNTRLDKDENDKWIGMGNQELLEYFSSYAAVKARHSYGPQGHRGMSLLIFEASAVGYIEADRLSEHFSENGRNRDAWERRSARFYPGGKRLLYGYMADKKDIDNFNQHSAGKSKLKFEMRSYKEAVWNPAKQMREDNQQLIWFKNKAAKHQMQAKALEESLSLVSEKHRQTLEENKIVRLKTKMHHEQIKEEMEFQEQFFKDQIKIIHDARTAREDNFEKTQQEQREMVKQSNANTASVEDHRVRAEKVAKFIKLQDKEMEEFVEERENLMRTHDDRIAALRRKYWEEEVELERKFDLELSKLMEKYSPKQSDEVNSSGTM q764f6_9gemi Protein V2 V2 protein protein tomato yellow leaf curl virus-mild [japan:atumi] tomato yellow leaf curl virus-mild [japan:atumi] MWDPLLNEFPESVHGFRCMLAIKYLQSVEETYEPNTLGHDLIRDLISVVRARDYVEATRRYNHFHARLEGSPKAELRQPIQQPCCCPHCPRHKQATIMDVQAHVPEAQNIQNVSKP D506F6E5AAF534BB a7xxz0_sollc 100134911 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MGSSENMDSGKVTGQKSQFSQTCNLLSQFLKKKGSVGDLNNLGIYKTTFESTGSQQTATTTTTTMNLLPMIEKSSDSSSSSSSVETNPQKPMNLFPQEFDFSKEQSTKKTESWKPDQPEKAQMTIFYGGQVIVFDDFPADKANEIMKLANKQNPTNNFTYPMIKNQKTADQSGVSFGNKLIQELPKLSMPQPSVADLPIARRNSLTRFLEKRKDRVTSIAPYQISNNKKSKNEDNKAWLGLGAQFVKTEQYF q6tdu2_sollc Coi1 543911 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MEERNSTRLSSSTNDTVWECVIPYIQESRDRDAVSLVCKRWWQIDAITRKHITMALCYTAKPEQLSRRFPHLESVKLKGKPRAAMFNLIPEDWGGYVTPWVMEITKSFSKLKALHFRRMIVRDSDLELLANRRGRVLQVLKLDKCSGFSTDGLLHISRSCKNLRTLLMEESYIIEKDGEWAHELALNNTVLENLNFYMTDLLQVRAEDLELIARNCKSLVSMKISECEITNLLGFFRAAAALEEFGGGAFNDQPELVVENGYNEHSGKYAALVFPPRLCQLGLTYLGRNEMSILFPIASRLRKLDLLYALLDTAAHCFLLQRCPNLEILETRNVVGDRGLEVLGQYCKRLKRLRIERGADDQEMEDEEGAVTHRGLIDLAKGCLELEYMAVYVSDITNEALEVIGTYLKNLSDFRLVLLDREERITDLPLDNGVRALLRGCHNLRRFALYVRPGGLTDVGLSYVGQYSPNVRWMLLGYVGESDHGLLEFSKGCPSLQKLEVRGCCFSERALALATLQLKSLRYLWVQGYRASSAGRDLLAMARPFWNIELIPARRVIANDGNNAETVVSEHPAHILAYYSLAGQRTDFPDTVKPLDPTYLLAE b2xvs2_sollc protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MERDFMGLNIKDSLLVVKDEPVESSKDSGFRWPMSSKVGVPHFMSLNSAQDENTFKALSATDGVDAGLKRQPGELQMKQVLGGIPVTAPHSMLPSRGSVAGTTEPWFNSKGSAAPAQLTIFYGGMVNVFEDISPEKAQAIMFLAGHGCAPPNVVQPRFQLQASASKPAAADGVCVNQTPNMLPASGLSSPMSVSSHPIGQSDGSSGNKDDMKMSKTANISVTPHVKLDTSKIVTSLGPVGATTIMTAAVPQARKASLARFLEKRKERVMNLAPYGLSKKSPECSTPESNGVGFSATSTPLLAGKET hpab1_psesh Effector protein hopAB1 hopAB1 virPphA Protein virPphA protein protein psesh Pseudomonas savastanoi pv. phaseolicola Pseudomonas syringae pv. phaseolicola MPGINGAGPSNFFWQWRTDGEPVTEREHDSSRSASSANSPELPPPASPAESGRQRLLRSSALSRQTREWLEATPARVQGATPPAEARQSPEAQQAERIVQELVRGGADLNNVRTMLRNVMDNNAVAFSRVERDILLQHFPNMPMTGISSDSVLANELRQRLRQTVRQQRIQSSTPARLADSSSGSSQRSLIGRSTMLMTPGRSSSSSAAASRTSVDRHPQGLDLESARLASAARHNHSANQTNEALRRLTQEGVDMERLRTSLGRYIMSLEPLPPDLRRALESVGINPFIPEELSLVDHPVLNFSAALNRMLASRQTTTNSPELPPLASSAESGRRRLLRSPPLLSGQREWIEQSMRQEAEPQSSRLNRAVRLAVMPPQNENEDNVAYAIRLRRLNPGADVSRVVASFITDPAARQQVVNDIRAALDIAPQFSQLRTISKADAESEELGFRDAADHPDNATSCLFGEELSLSNPDQQVIGLAVNPTDKPQPYSQEVNKALTFMDMKKLAQYLADKPEHPLNRQRLDAKNIAKYAFKIVP hpab2_psesm Effector protein HopAB2 hopAB2 avrPtoB PSPTO_3087 Avirulence protein AvrPtoB protein protein psesm Pseudomonas syringae pv. tomato (strain DC3000) MAGINRAGPSGAYFVGHTDPEPVSGQAHGSGSGASSSNSPQVQPRPSNTPPSNAPAPPPTGRERLSRSTALSRQTREWLEQGMPTAEDASVRRRPQVTADAATPRAEARRTPEATADASAPRRGAVAHANSIVQQLVSEGADISHTRNMLRNAMNGDAVAFSRVEQNIFRQHFPNMPMHGISRDSELAIELRGALRRAVHQQAASAPVRSPTPTPASPAASSSGSSQRSLFGRFARLMAPNQGRSSNTAASQTPVDRSPPRVNQRPIRVDRAAMRNRGNDEADAALRGLVQQGVNLEHLRTALERHVMQRLPIPLDIGSALQNVGINPSIDLGESLVQHPLLNLNVALNRMLGLRPSAERAPRPAVPVAPATASRRPDGTRATRLRVMPEREDYENNVAYGVRLLNLNPGVGVRQAVAAFVTDRAERPAVVANIRAALDPIASQFSQLRTISKADAESEELGFKDAADHHTDDVTHCLFGGELSLSNPDQQVIGLAGNPTDTSQPYSQEGNKDLAFMDMKKLAQFLAGKPEHPMTRETLNAENIAKYAFRIVP rs27a_sollc Ubiquitin-40S ribosomal protein S27a UBI3 RPS27A protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDDTGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGGD This sequence has been withdrawn from Uniprot. 4A85C770FFC26B76 td2_sollc Threonine dehydratase 2 biosynthetic, chloroplastic TD2 SlTD2 TD Threonine deaminase 2 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MEFLCLAPTRSFSTNPKLTKSIPSDHTSTTSRIFTYQNMRGSTMRPLALPLKMSPIVSVPDITAPVENVPAILPKVVPGELIVNKPTGGDSDELFQYLVDILASPVYDVAIESPLELAEKLSDRLGVNFYIKREDKQRVFSFKLRGAYNMMSNLSREELDKGVITASAGNHAQGVALAGQRLNCVAKIVMPTTTPQIKIDAVRALGGDVVLYGKTFDEAQTHALELSEKDGLKYIPPFDDPGVIKGQGTIGTEINRQLKDIHAVFIPVGGGGLIAGVATFFKQIAPNTKIIGVEPYGAASMTLSLHEGHRVKLSNVDTFADGVAVALVGEYTFAKCQELIDGMVLVANDGISAAIKDVYDEGRNILETSGAVAIAGAAAYCEFYKIKNENIVAIASGANMDFSKLHKVTELAGLGSGKEALLATFMVEQQGSFKTFVGLVGSLNFTELTYRFTSERKNALILYRVNVDKESDLEKMIEDMKSSNMTTLNLSHNELVVDHLKHLVGGSANISDEIFGEFIVPEKAETLKTFLDAFSPRWNITLCRYRNQGDINASLLMGFQVPQAEMDEFKNQADKLGYPYELDNYNEAFNLVVSE pti1_sollc Pto-interacting protein 1 Pto kinase interactor 1 PTI1 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MSCFSCCDDDDMHRATDNGPFMAHNSAGNNGGQRATESAQRETQTVNIQPIAVPSIAVDELKDITDNFGSKALIGEGSYGRVYHGVLKSGRAAAIKKLDSSKQPDREFLAQVSMVSRLKDENVVELLGYCVDGGFRVLAYEYAPNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHIIHRDIKSSNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVKQCVDARLNTDYPPKAIAKMAAVAALCVQYEADFRPNMSIVVKALQPLLPRPVPS mint q40234_solpi Pto protein protein solpi Solanum pimpinellifolium Currant tomato Lycopersicon pimpinellifolium MGSKYSKATNSINDALSSSYLVPFESYRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFCRHPHLVSLIGFCDERNEMILIYKYMENGNLKRHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAIIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVKGTLGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGDTAVKCLALSSEDRPSMGDVLWKLEYALRLQESVI mint tm1r_sollc ToMV resistance protein Tm-1(GCR237) Disease resistance protein Tm-1 Protein p80(GCR237) Tm-1 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MATAQSNSPRVFCIGTADTKFDELRFLSEHVRSSLNSFSNKSSFKVGVTVVDVSTSWKETNSCADFDFVPSKDVLSCHTLGEETMGTFADIRGLAIAIMSKALETFLSIANDEQNLAGVIGLGGSGGTSLLSSAFRSLPIGIPKVIISTVASGQTESYIGTSDLVLFPSVVDICGINNVSKVVLSNAGAAFAGMVIGRLESSKEHSITNGKFTVGVTMFGVTTPCVNAVKERLVKEGYETLVFHATGVGGRAMEDLVRGGFIQGVLDITTTEVADYVVGGVMACDSSRFDAILEKKIPLVLSVGALDMVNFGPKTTIPPEFQQRKIHEHNEQVSLMRTTVGENKKFAAFIAEKLNKASSSVCVCLPEKGVSALDAPGKDFYDPEATSCLTRELQMLLENNERCQVKVLPYHINDAEFANALVDSFLEISPKSRHVECQPAESKSIQDIQNDNAVLEKYPSCNGKNFSRLNDFPNAKPETLQKRTVILQKLKDQISKGKPIIGAGAGTGISAKFEEAGGVDLIVLYNSGRFRMAGRGSLAGLLPFADANAIVLEMANEVLPVVKEVAVLAGVCATDPFRRMDNFLKQLESVGFCGVQNFPTVGLFDGNFRQNLEETGMGYGLEVEMIAAAHRMGLLTTPYAFCPDEAVAMAEAGADIIVAHMGLTTSGSIGAKTAVSLEESVTCVQAIADATHRIYPDAIVLCHGGPISSPEEAAYVLKRTTGVHGFYGASSMERLPVEQAITATVQQYKSISME q80lg0_9viru Methyltransferase/RNA helicase Replicase large subunit Replicase small subunit protein protein tomato mosaic virus Tomato mosaic virus MAYTQTATSSALLETVRGNNTLVNDLAKRRLYDTAVDEFNARDRRPKVNFSKVVSEEQTLIATKAYPEFQITFYNTQNAVHSLAGGLRSLELEYLMMQIPYGSLTYDIGGNFASHLFKGRAYVHCCMPNLDVRDIMRHEGQKDSIELYLSRLERGNKHVPNFQKEAFDRYAEMPNEVVCHDTFQTCRHSQECYTGRVYAIALHSIYDIPADEFGAALLRKNVHVCYAAFHFSENLLLEDSHVNLDEINACFQRDGDRLTFSFASESTLNYSHSYSNILKYVCKTYFPASNREVYMKEFLVTRVNTWFCKFSRIDTFLLYKGVAHKGVDSEQFYKAMEDAWHYKKTLAMCNSERILLEDSSSVNYWFPKMRDMVIVPLFDISLETSKRTRKEVLVSKDFVYTVLNHIRTYQAKALTYSNVLSFVESIRSRVIINGVTARSEWDVDKSLLQSLSMTFFLHTKLAVLKDDLLISKFALGPKTVSQHVWDEISLAFGNAFPSIKERLINRKLIKITENALEIRVPDLYVTFHDRLVSEYKMSVDMPVLDIRKKMEETEEMYNALSELSVLKNSDKFDVDVFSQMCQSLEVDPMTAAKVIVAVMSNESGLTLTFEQPTEANVALALQDSEKASDGALIVTSRDVEEPSIKGSMARGELQLAGLSGDVPESSYTRSEEIESLEQFHMATASSLIHKQMCSIVYTGPLKVQQMKNFIDSLVASLSAAVSNLVKILKDTAAIDLETRQKFGVLDVASKRWLVKPSAKDHAWGVVETHARKYHVALLEHDEFGIITCDNWRRVAVSSESVVYSDMAKLRTLRRLLKDGEPHVSSAKVVLVDGVPGCGKTKEILSRVNFEEDLILVPGRQAAEMIRRRANASGIIVATKDNVRTVDSFLMNYGKRARCQFKRLFIDEGLMLHTGCVNFLVEMSLCDIAYVYGDTQQIPYINRVTGFPYPAHFAKLEVDEVETRRTTLRCPADVTHFLNQRYEGHVMCTSSEKKSVSQEMVSGAASINPVSKPLKGKILTFTQSDKEALLSRGYADVHTVHEVQGETYADVSLVRLTPTPVSIIARDSPHVLVSLSRHTKSLKYYTVVMDPLVSIIRDLERVSSYLLDMYKVDAGTQXQLQVDSVFKNFNLFVAAPKTGDISDMQFYYDKCLPGNSTLLNNYDAVTMKLTDISLNVKDCILDMSKSVAAPKDVKPTLIPMVRTAAEMPRQTGLLENLVAMIKRNFNSPELSGVVDIENTASLVVDKFFDSYLLKEKRKPNKNFSLFSRESLNRWIAKQEQVTIGQLADFDFVDLPAVDQYRHMIKAQPKQKLDLSIQTEYPALQTIVYHSKKINAIFGPLFSELTRQLLDSIDSSRFLFFTRKTPAQIEDFFGDLDSHVPMDVLELDVSKYDKSQNEFHCAVEYEIWRRLGLEDFLAEVWKQGHRKTTLKDYTAGIKTCLWYQRKSGDVTTFIGNTVIIASCLASMLPMEKLIKGAFCGDDSLLYFPKGCEYPDIQQAANLMWNFEAKLFKKQYGYFCGRYVIHHDRGCIVYYDPLKLISKLGAKHIKDWDHLEEFRRSLCDVAESLNNCAYYTQLDDAVGEVHKTAPPGSFVYKSLVKYLSDKVLFRSLFLDGSSC q80lf9_9viru protein protein tomato mosaic virus Tomato mosaic virus MAYTQTATSSALLETVRGNNTLVNDLAKRRLYDTAVDEFNARDRRPKVNFSKVVSEEQTLIATKAYPEFQITFYNTQNAVHSLAGGLRSLELEYLMMQIPYGSLTYDIGGNFASHLFKGRAYVHCCMPNLDVRDIMRHEGQKDSIELYLSRLERGNKHVPNFQKEAFDRYAEMPNEVVCHDTFQTCRHSQECYTGRVYAIALHSIYDIPADEFGAALLRKNVHVCYAAFHFSENLLLEDSHVNLDEINACFQRDGDRLTFSFASESTLNYSHSYSNILKYVCKTYFPASNREVYMKEFLVTRVNTWFCKFSRIDTFLLYKGVAHKGVDSEQFYKAMEDAWHYKKTLAMCNSERILLEDSSSVNYWFPKMRDMVIVPLFDISLETSKRTRKEVLVSKDFVYTVLNHIRTYQAKALTYSNVLSFVESIRSRVIINGVTARSEWDVDKSLLQSLSMTFFLHTKLAVLKDDLLISKFALGPKTVSQHVWDEISLAFGNAFPSIKERLINRKLIKITENALEIRVPDLYVTFHDRLVSEYKMSVDMPVLDIRKKMEETEEMYNALSELSVLKNSDKFDVDVFSQMCQSLEVDPMTAAKVIVAVMSNESGLTLTFEQPTEANVALALQDSEKASDGALIVTSRDVEEPSIKGSMARGELQLAGLSGDVPESSYTRSEEIESLEQFHMATASSLIHKQMCSIVYTGPLKVQQMKNFIDSLVASLSAAVSNLVKILKDTAAIDLETRQKFGVLDVASKRWLVKPSAKDHAWGVVETHARKYHVALLEHDEFGIITCDNWRRVAVSSESVVYSDMAKLRTLRRLLKDGEPHVSSAKVVLVDGVPGCGKTKEILSRVNFEEDLILVPGRQAAEMIRRRANASGIIVATKDNVRTVDSFLMNYGKRARCQFKRLFIDEGLMLHTGCVNFLVEMSLCDIAYVYGDTQQIPYINRVTGFPYPAHFAKLEVDEVETRRTTLRCPADVTHFLNQRYEGHVMCTSSEKKSVSQEMVSGAASINPVSKPLKGKILTFTQSDKEALLSRGYADVHTVHEVQGETYADVSLVRLTPTPVSIIARDSPHVLVSLSRHTKSLKYYTVVMDPLVSIIRDLERVSSYLLDMYKVDAGTQ hopab2-ub-1 3141577 N/A 3141581 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3141582 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false hopab2-ub-2 3141578 N/A 3141581 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3141582 unspecified role unspecified role bait bait Region 308-553 Region 308-553 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q8RSY1:p.[Lys512Arg;Lys529Arg] K512R/K529R mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false hopab2-ub-3 3141579 N/A 3141581 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3141582 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false hopab1-ub-1 3141580 N/A 3141583 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3141581 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false td-1 3223688 N/A 3223690 unspecified role unspecified role unspecified role unspecified role Region 52-418 Region 52-418 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false td-2 3223689 N/A 3223690 unspecified role unspecified role unspecified role unspecified role sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato direct interaction direct interaction false false false tm1^gcr237-q80lf9_9viru-1 3159877 N/A 3159878 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro N/A 3159879 unspecified role unspecified role prey prey in vitro In vitro N/A 3159880 unspecified role unspecified role prey prey in vitro In vitro association association false false false a7xxz0_sollc-coi1-2 3171027 N/A 3171029 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3171030 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato physical association physical association false false false jaz3-coi1-1 3171028 N/A 3171031 unspecified role unspecified role bait bait Region 149-306 Region 149-306 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3171030 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato physical association physical association false false false opr3-1 3148169 N/A 3148173 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false opr3-2 3148170 N/A 3148173 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false opr3-3 3148171 N/A 3148173 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false opr3-4 3148172 N/A 3148173 unspecified role unspecified role unspecified role unspecified role Q9FEW9:p.Glu291Lys E291K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false coi1-a7xxz0_sollc-1 3159120 N/A 3171029 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3171030 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false a7xxz0_sollc-coi1-1 3159122 N/A 3171029 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3171030 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato physical association physical association false false false v2-sgs3-1 3165962 N/A 3165966 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3165967 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false v2-sgs3-2 3165963 N/A 3165966 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3165967 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false v2-sgs3-3 3165964 N/A 3165966 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false tobac Nicotiana tabacum (Common tobacco) Common tobacco N/A 3165967 unspecified role unspecified role fluorescence donor fluorescence donor CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false tobac Nicotiana tabacum (Common tobacco) Common tobacco direct interaction direct interaction false false false pti1-pto-1 3159701 N/A 3159709 enzyme target enzyme target substrate substrate unspecified role unspecified role Q41328:p.Lys96Gln K96Q mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3159710 enzyme enzyme unspecified role unspecified role Q40234:p.Thr199Ala T199A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false sbt3-1 3196597 N/A 3196600 unspecified role unspecified role unspecified role unspecified role Mature protein Region 113-761 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato direct interaction direct interaction false false false sbt3-2 3196598 N/A 3196600 unspecified role unspecified role unspecified role unspecified role Mature protein Region 113-761 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato direct interaction direct interaction false false false sbt3-3 3196599 N/A 3196600 unspecified role unspecified role unspecified role unspecified role Mature protein Region 113-761 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false nicbe Nicotiana benthamiana direct interaction direct interaction false false false IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ reinders-2002-1 Intra- and intermolecular interactions in sucrose transporters at the plasma membrane detected by the split-ubiquitin system and functional assays. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Reinders A., Schulze W., Thaminy S., Stagljar I., Frommer WB., Ward JM. frommer@zmbp.uni-tuebingen.de Structure (0969-2126) 2002 Only protein-protein interactions imex curation reinders-2002a-1 Protein-protein interactions between sucrose transporters of different affinities colocalized in the same enucleate sieve element. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Reinders A., Schulze W., Kuhn C., Barker L., Schulz A., Ward JM., Frommer WB. To reduce signals caused by autoactivation or colocalization in the same compartment, an improved system was developed using the weak wheat germ agglutinin binding protein ( WBP1 ) promoter driving the Cub fusion. frommer@zmbp.uni-tuebingen.de; Plant Cell (1040-4651) 2002 Only protein-protein interactions imex curation lin-2009a-1 AtTRP1 encodes a novel TPR protein that interacts with the ethylene receptor ERS1 and modulates development in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lin Z., Ho C.W., Grierson D. donald.grierson@nottingham.ac.uk J. Exp. Bot. (0022-0957) 2009 Only protein-protein interactions imex curation devarenne-2011-2 The plant cell death suppressor Adi3 interacts with the autophagic protein Atg8h. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Devarenne T.P. tpd8@tamu.edu Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation devarenne-2011-1 The plant cell death suppressor Adi3 interacts with the autophagic protein Atg8h. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Devarenne T.P. tpd8@tamu.edu cDNA prey library developed from Pst (Pseudomonas syringae pv. tomato) exposed tomato leaves. Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation melotto-2008-3 A critical role of two positively charged amino acids in the Jas motif of Arabidopsis JAZ proteins in mediating coronatine- and jasmonoyl isoleucine-dependent interaction with the COI1 F-box protein. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Melotto M., Mecey C., Niu Y., Chung HS., Katsir L., Yao J., Zeng W., Thines B., Staswick P., Browse J., Howe G., He SY. Leaf extracts of transgenic Tomato plants expressing a myc tagged Tomato COL1 protein were used in this assay. hes@msu.edu Plant J. (0960-7412) 2008 lin-2008b-1 SlTPR1, a tomato tetratricopeptide repeat protein, interacts with the ethylene receptors NR and LeETR1, modulating ethylene and auxin responses and development. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lin Z., Arciga-Reyes L., Zhong S., Alexander L., Hackett R., Wilson I., Grierson D. It was not possible to unambiguously identify other interacting proteins mentioned in Table 1 of the paper. Therefore, these protein interactions were not curated. donald.grierson@nottingham.ac.uk Tomato ripening fruit cDNA library J. Exp. Bot. (0022-0957) 2008 Only protein-protein interactions imex curation lin-2008b-2 SlTPR1, a tomato tetratricopeptide repeat protein, interacts with the ethylene receptors NR and LeETR1, modulating ethylene and auxin responses and development. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lin Z., Arciga-Reyes L., Zhong S., Alexander L., Hackett R., Wilson I., Grierson D. It was not possible to unambiguously identify other interacting proteins mentioned in Table 1 of the paper. Therefore, these protein interactions were not curated. donald.grierson@nottingham.ac.uk Tomato ripening fruit cDNA library J. Exp. Bot. (0022-0957) 2008 Only protein-protein interactions imex curation lin-2008b-3 SlTPR1, a tomato tetratricopeptide repeat protein, interacts with the ethylene receptors NR and LeETR1, modulating ethylene and auxin responses and development. allce Allium cepa (Onion) Onion confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Lin Z., Arciga-Reyes L., Zhong S., Alexander L., Hackett R., Wilson I., Grierson D. It was not possible to unambiguously identify other interacting proteins mentioned in Table 1 of the paper. Therefore, these protein interactions were not curated. donald.grierson@nottingham.ac.uk Tomato ripening fruit cDNA library J. Exp. Bot. (0022-0957) 2008 Only protein-protein interactions imex curation bernhardt-2006-5 CUL4 associates with DDB1 and DET1 and its downregulation affects diverse aspects of development in Arabidopsis thaliana. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Bernhardt A., Lechner E., Hano P., Schade V., Dieterle M., Anders M., Dubin MJ., Benvenuto G., Bowler C., Genschik P., Hellmann H. Protein extracts from transgenic Arabidopsis expressing myc (epitope) tagged tomato DET1 protein were used in this study. hellmann@zedat.fu-berlin.de Plant J. (0960-7412) 2006 Only protein-protein interactions imex curation bernhardt-2006-6 CUL4 associates with DDB1 and DET1 and its downregulation affects diverse aspects of development in Arabidopsis thaliana. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bernhardt A., Lechner E., Hano P., Schade V., Dieterle M., Anders M., Dubin MJ., Benvenuto G., Bowler C., Genschik P., Hellmann H. Protein extratcts from transgenic Arabidopsis plants expressing epitope tagged tomato DET1 protein were used in this study. hellmann@zedat.fu-berlin.de Plant J. (0960-7412) 2006 Only protein-protein interactions imex curation gindullis-1999-2 MAF1, a novel plant protein interacting with matrix attachment region binding protein MFP1, is located at the nuclear envelope. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gindullis F., Peffer NJ., Meier I. meieri@ esvax.dnet.dupont.com Tomato leaf cDNA library Plant Cell (1040-4651) 1999 Only protein-protein interactions imex curation gindullis-1999-1 MAF1, a novel plant protein interacting with matrix attachment region binding protein MFP1, is located at the nuclear envelope. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gindullis F., Peffer NJ., Meier I. meieri@ esvax.dnet.dupont.com Tomato leaf cDNA library Plant Cell (1040-4651) 1999 Only protein-protein interactions imex curation gindullis-1999-3 MAF1, a novel plant protein interacting with matrix attachment region binding protein MFP1, is located at the nuclear envelope. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting antibody detection identification by antibody antibody detection Gindullis F., Peffer NJ., Meier I. meieri@ esvax.dnet.dupont.com Tomato leaf cDNA library Plant Cell (1040-4651) 1999 Only protein-protein interactions imex curation caplan-2008-1 Chloroplastic protein NRIP1 mediates innate immune receptor recognition of a viral effector. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Caplan JL., Mamillapalli P., Burch-Smith TM., Czymmek K., Dinesh-Kumar SP. Tobacco leaves were transformed with expression constructs of epitope tagged proteins of interest, using Agroinfiltration using the GV2260 Agrobacterium strain. dinesh-kumar@yale.edu,savithramma.dinesh-kumar@yale.edu dinesh-kumar@yale.edu Solanum lycopersicum (Tomato) cDNA library Cell (0092-8674) 2008 Only protein-protein interactions 8 imex curation q41341_sollc Never-ripe ETR3 544279 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MESCDCIEALLPTGDLLVKYQYLSDFFIAVAYFSIPLELIYFVHKSACFPYRWVLMQFGAFIVLCGATHFISLWTFFMHSKTVAVVMTISKMLTAAVSCITALMLVHIIPDLLSVKTRELFLKTRAEELDKEMGLIIRQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLDLAECALWMPCQGGLTLQLSHNLNNLIPLGSTVPINLPIINEIFSSPEAIQIPHTNPLARMRNTVGRYIPPEVVAVRVPLLHLSNFTNDWAELSTRSYAVMVLVLPMNGLRKWREHELELVQVVADQVAVALSHAAILEDSMRAHDQLMEQNIALDVARQEAEMAIRARNDFLAVMNHEMRTPMHAVIALCSLLLETDLTPEQRVMIETILKSSNLLATLINDVLDLSRLEDGILELENGTFNLHGILREAVNLIKPIASLKKLSITLALALDLPILAVGDAKRLIQTLLNVAGNAVKFTKEGHISIEASVAKPEYARDCHPPEMFPMPSDGQFYLRVQVRDTGCGISPQDIPLVFTKFAESRPTSNRSTGGEGLGLAICRRFIQLMKGNIWIESEGPGKGTTVTFVVKLGICHHPNALPLLPMPPRGRLNKGSDDLFRYRQFRGDDGGMSVNAQRYQRSL trp1_arath Telomere repeat-binding protein 1 TRP1 F2O15.20 At5g59430 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVSHKCVEEFGYASYLVPSNARAPRSARKRRSIEKRISKEDDNMCAIDLLATVAGHLSFESGSSLMSIDKLIEDHRVKEEFPEEEKPLMPVALSPYRGSLSPCGFSSVINGKVENEVDGFSYSGGSDACQVGNFSQDVKPDIDGDAVVLDARPNVVVSLGSSSRTEVPSIGNCVSHGVRDDVNLFSRDDDENFSKYIHPRVTKHSPRTVPRIGDRRIRKILASRHWKGGSRHSDTKPWRNYYLHQQRSYPIKKRKNFDHISDSVTDDYRMRTKMHRGSRKGQGASFVASDSHVKLRIKSFRVPELFIEIPETATVGSLKRMVMEAVSTLLSDGHRVGLMVQGKKVRDDNKTLHQTGISQDNSHLDSLDFSLEPSSEMPQLLTSHPLGHACEELLPVCQATKIDNVLESDHHDSALFPSDSLGNNNVTEDSKAMISVALNELSSQSQPPSRKSRRSEQQQQQAAQRRIRRPFSVAEVEALVQAVEKLGTGRWRDVKLCAFEDADHRTYVDLKDKWKTLVHTAKISPQQRRGEPVPQELLNRVLNAHGYWTQQQMQQLQQNVNKLEQETQSQTTEGLLLL ers1_arath Ethylene response sensor 1 ERS1 ERS At2g40940 Protein ERS1 T20B5.14 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESCDCFETHVNQDDLLVKYQYISDALIALAYFSIPLELIYFVQKSAFFPYKWVLMQFGAFIILCGATHFINLWMFFMHSKAVAIVMTIAKVSCAVVSCATALMLVHIIPDLLSVKNRELFLKKKADELDREMGLILTQEETGRHVRMLTHGIRRTLDRHTILRTTLVELGKTLCLEECALWMPSQSGLYLQLSHTLSHKIQVGSSVPINLPIINELFNSAQAMHIPHSCPLAKIGPPVGRYSPPEVVSVRVPLLHLSNFQGSDWSDLSGKGYAIMVLILPTDGARKWRDHELELVENVADQVAVALSHAAILEESMHARDQLMEQNFALDKARQEAEMAVHARNDFLAVMNHEMRTPMHAIISLSSLLLETELSPEQRVMIETILKSSNLVATLISDVLDLSRLEDGSLLLENEPFSLQAIFEEVISLIKPIASVKKLSTNLILSADLPTYAIGDEKRLMQTILNIMGNAVKFTKEGYISIIASIMKPESLQELPSPEFFPVLSDSHFYLCVQVKDTGCGIHTQDIPLLFTKFVQPRTGTQRNHSGGGLGLALCKRFVGLMGGYMWIESEGLEKGCTASFIIRLGICNGPSSSSGSMALHLAAKSQTRPWNW etr1_sollc Ethylene receptor 1 ETR1 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MGSLLRMNRLLSSIVESCNCIIDPQLPADDLLMKYQYISDFFIALAYFSIPVELIYFVKKSAVFPYRWVLVQFGAFIVLCGATHLINLWTFNMHTRNVAIVMTTPKALTALVSCITALMLVHIIPDLLSVKTRELFLKKKAAQLDREMGIIRTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLALEECALWMPTRTGLELQLSYTLRHQNPVGLTVPIQLPVINQVFGTNHVVKISPNSPVARLRPAGKYMPGEVVAVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSDSARQWHVHELELVEVVADQVAVALSHAAILEESMRARDLLMEQNVALDLARREAEMAVRARNDFLAVMNHEMRTPMHAIIALSSLLQETDLTPEQRLMVETILKSSNLLATLINDVLDLSRLEDGSLQLDIGTFNLHALFREVHSLIKPIASVKKLFVTLSLSSDLPEYVIGDEKRLMQILLNVVGNAVKFSKEGNVSISAFVAKSDSLRDPRAPEFFAVPSENHFYLRVQIKDTGIGITPQDIPNLFSKFTQSQALATTNSGGTGLGLAICKRFVNLMEGHIWIESEGLGKGSTAIFIIKLGIPGRANESKLPFVTKLPANHTQMSFQGLKVLVMDENGVSRMVTKGLLTHLGCDVTTVGSRDECLRVVTHEHKVVIMDVSMQGIDCYEVAVVIHERFGKRHGRPLIVALTGNTDRVTKENCMRVGMDGVILKPVSVYKMRSVLSELLEHGVVLES b6gva2_sollc int106 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MVSIEQVESPAAGKTSTAAEAPSGYVSDGYETASDSELNGAENGSNRESENTINTASSSSDGDFLKEKTQEQQPEVNQEQLNEKALAQANDAKVEGNALFKDGLYEEALSKYELALQVAADIPSSTEIRSICHANRAACFTKLGKHEETIKECTKALELNPTYIKALVRRAEAHEKLEHFEEAITDMTKILELEPSHDQARRTVILLKPLADEKREKMKEEMIGKLKEMGNSILGRFGMSVDNFKTVKDPNTGSYSVQFQK ti10a_arath Protein TIFY 10A TIFY10A JAZ1 At1g19180 T29M8.5 Jasmonate ZIM domain-containing protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSMECSEFVGSRRFTGKKPSFSQTCSRLSQYLKENGSFGDLSLGMACKPDVNGTLGNSRQPTTTMSLFPCEASNMDSMVQDVKPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKPESQTAPLTIFYAGQVIVFNDFSAEKAKEVINLASKGTANSLAKNQTDIRSNIATIANQVPHPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASSNPQTTGNMSWLGLAAEI coi1_tomato_protein Coronatine-insensitive protein 1 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato An amino acid sequence which is not represented in UniProt The only sequence available is the nucleotide sequence of the EST clone EST531894 tomato rbx1a_arath RING-box protein 1a ROC1 RBX1a-At At-Rbx1;1 RBX1-2 Protein RING of cullins 1 RBX1A At5g20570 F7C8.160 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATLDSDVTMIPAGEASSSVAASSSNKKAKRFEIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH cul4_arath Cullin-4 CUL4 MDE13.3 At5g46210 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLPTKRSTFSAASASDDSSYSSPPMKKAKNDLHHSPQHPNTADKVVGFHMEEDPTPAAANLSRKKATLPQPTKKFVIKLNKAKPTLPTNFEENTWEKLQSAIRAIFLKKKISFDLESLYQAVDNLCLHKLDGKLYDQIEKECEEHISAALQSLVGQNTDLTVFLSRVEKCWQDFCDQMLMIRSIALTLDRKYVIQNPNVRSLWEMGLQLFRKHLSLAPEVEQRTVKGLLSMIEKERLAEAVNRTLLSHLLKMFTALGIYMESFEKPFLEGTSEFYAAEGMKYMQQSDVPEYLKHVEGRLHEENERCILYIDAVTRKPLITTVERQLLERHILVVLEKGFTTLMDGRRTEDLQRMQTLFSRVNALESLRQALSSYVRKTGQKIVMDEEKDKDMVQSLLDFKASLDIIWEESFYKNESFGNTIKDSFEHLINLRQNRPAELIAKFLDEKLRAGNKGTSEEELESVLEKVLVLFRFIQGKDVFEAFYKKDLAKRLLLGKSASIDAEKSMISKLKTECGSQFTNKLEGMFKDIELSKEINESFKQSSQARTKLPSGIEMSVHVLTTGYWPTYPPMDVKLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTSIEDKELRRTLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDEFAAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLEREKSNPQIYNYLA det1_sollc Light-mediated development protein DET1 DET1 dg hp2 Deetiolated1 homolog tDET1 High pigmentation protein 2 Protein dark green protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MFKTNNVTARLFERQICTPAPGTSIHRARRFYENVVPSYTIYDVECPDHSFRKFTDDGLYFVSFSRNHQDLVVYRPTWLTFSCKEEDCDTHDLPLKARKFESFFTQLYSVTLASSGELICKDFFLYMESNQFGLFATSTAQIHDAPPTGGAIQGVPSVEKITFHLLRLVDGAILDERVFHNDYVNLAHSIGAFLYDDLLAIVSLRYQRIHILQIRDSGDLVDVRAIGEFCREDDELFLNSNSQVLVNHVGNGFHHSLPQSETSFLSGIKQRLLSYIFRGIWNEADQTMRVQCLKKKFYFHFQDYIDLIIWKVQFLDRHHLLIKFGSVDGGVSRNADIHPSFFAVYNMETTEIVAFYQNSADELYFLFELFSDHFHVSSKSSLHMNFMSSHSNNIHALEQLRCTKNKATNFSQFVKKMMASLPCSCQSQSPSPYFDQSLFRFDEKLISAIDRHRQSTDHPIKFISRRQPNILKFKMKPGPEAGSTDGRTKKICSFLFHPILPLALSVQQTLFLQASVVNIHFRR q43653_soltu SUT1 protein protein soltu Solanum tuberosum (Potato) Potato MENGTKREGLGKLTVSSSLQVEQPLAPSKLWKIIVVASIAAGVQFGWALQLSLLTPYVQLLGIPHKFASFIWLCGPISGMIVQPVVGYYSDNCSSRFGRRRPFIAAGAALVMIAVFLIGFAADLGHASGDTLGKGFKPRAIAVFVVGFWILDVANNMLQGPCRALLADLSGGKSGRMRTANAFFSFFMAVGNILGYAAGSYSHLFKVFPFSKTKACDMYCANLKSCFFIAIFLLLSLTTIALTLVRENELPEKDEQEIDEKLAGAGKSKVPFFGEIFGALKELPRPMWILLLVTCLNWIAWFPFFLYDTDWMAKEVFGGQVGDARLYDLGVRAGAMGLLLQSVVLGFMSLGVEFLGKKIGGAKRLWGILNFVLAICLAMTILVTKMAEKSRQHDPAGTLMGPTPGVKIGALLLFAALGIPLAATFSIPFALASIFSSNRGSGQGLSLGVLNLAIVVPQMLVSLVGGPWDDLFGGGNLPGFVVGAVAAAASAVLALTMLPSPPADAKPAVAMGLSIK q40167_sollc LeSUT1 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MENGTKGKLTVSSSLQIEQPLPPSKLWKIIVVASIAAGVQFGWALQLSLLTPYVQLLGIPHRFASFIWLCGPISGMIVQPVVGYYSDNCSSRFGRRRPFIAAGAALVTIAVFLIGFAADLGHASGDPLGKGSKPRAIAVFVVGFWILDVANNMLQGPCRALLADLSGGKSGKMRTANAFFSFFKAVGNILGYAAGSYSRLFKVFPFSKTKACDMYRANLKSCFFIAIFLLLSLTTLALTLVRENELPEKEELEIDEKLSGAGKSKVPFFGEIFGALKDLPRPMWILLLVTCLNWIAWFPFFLYDTDWMAKEVFGGQVGDAKLYDLGVRAGALGLLLQSVVLGFMSLGVEFLGKKIGGAKRLWGILNFVLAICLAMTILVTKMAEKSRGHDAAGTLMGPTPGVKIGALLLFAALGIPLAVTFSIPFALAS q9fvl6_sollc SUT2 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MDAVSIRVPYKNLKQQEVELTNVDESRFAQLEIRSDSSSPRVSNGEMNDSNLPLPPPPVRNSLLTLILSCTVAAGVQFGWALQLSLLTPYIQTLGIEHAFSSFIWLCGPITGLVVQPCVGIWSDKCHSKYGRRRPFIFIGAVMISIAVIIIGFSADIGYLLGDTKEHCSTFKGTRSRAAIVFVVGFWMLDLANNTVQGPARALLADLSGPDQRNTANAVFCSWMAVGNILGFSAGASGGWHRWFPFLTNRACCEPCGNLKAAFLVAVVFLTLCTLVTLYFANEVPLSPKQYKRMSDSAPLLDSPQNTGFDLSQSKRELQYRNSVANNESEMGHVADNSPKNEEQRPDKDQGDSFADSPGAVLVNLLTSLRHLPPAMHSVLIVMALTWLSWFPFFLFDTDWMGREVYHGDPKGEADEVNAYNQGVREGAFGLLLNSVVLGVSSFLIEPMCKWIGSRLVWAVSNFIVFVCMACTAIISVVSISANTQGVQHVIGATRSTQIAALVVFSLLGIPLAVTYSVPFSITAELTADAGGGQGLAIGVLNLAIVVPQMVVSLGAGPWDALFGGGNIPAFALASLAALAAGIFAMLRLPNLSSNFKSTGFHFG q9fvj6_sollc SUT4 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MPEIERHRTRHNRPAIREPVKPRVPLRLLLRVASVAGGIQFGWALQLSLLTPYVQELGIPHAWASIIWLCGPLSGLLVQPLVGHMSDKCTSRFGRRRPFIVAGAASIMIAVLIIGFSADIGWLLGDRGEIKVRAIAAFVVGFWLLDVANNMTQGPCRALLADLTQKDHRRTRVANAYFSLFMAIGNILGFATGSYSGWYKIFLFTLNTACTINCANLKAAFILDIIFIATTTCISISAANEQPLDPSRGSSHTGEEIDESSHGQEEAFLWELFGIFKYFPGVVWVILLVTALTWIGWFPFLLFDTDWFGREIYGGEPNDGKNYSAGVRMGSLGLMLNSVLLGLTSLFMEKLCRKWGAGFTWGVSNVVMSLCFIAMLIITAVRSNIDIGQGLPPDGIVIAALVVFSILGIPLAITYSVPYALVSSRIEALGLGQGLSMGVLNLAIVFPQIVVSLGSGPWDELFGGGNSPAFVVAALSAFAAGLIAILAIPRTRVERPKIFA maf1_sollc MFP1 attachment factor 1 MAF1 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MAEIDSAQSQETVTQETQNKPMTTSFSIWPPTQRTRDAVINRLIESLSTPSILSKRYGTLPQDEASETARLIEEEAFAAAGSTASDADDGIEILQVYSKEISKRMIDTVKSRSAPAAASEGESKPSELPADASEPSSASGLTGEVSSVETEP mfp1_sollc MAR-binding filament-like protein 1 MFP1 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MATSCFPPFSASSSSLCSSQFTPLLSCPRNTQICRKKRPVMASMHSENQKESNVCNRRSILFVGFSVLPLLNLRARALEGLSTDSQAQPQKEETEQTIQGSAGNPFVSLLNGLGVVGSGVLGSLYALARNEKAVSDATIESMKNKLKDKEDAFVSMKKQFESELLSEREDRNKLIRREGEERQALVNQLKSAKTTVISLGQELQNEKKLAEDLKFEIKGLQNDLMNTKEDKKKLQEELKEKLDLIQVLEEKITLLTTEIKDKEVSLRSNTSKLAEKESEVNSLSDMYQQSQDQLMNLTSEIKELKDEIQKRERELELKCVSEDNLNVQLNSLLLERDESKKELHAIQKEYSEFKSNSDEKVASDATLGEQEKRLHQLEEQLGTALSEASKNEVLIADLTREKENLRRMVDAELDNVNKLKQEIEVTQESLENSRSEVSDITVQLEQLRDLSSKLEREVSKLQMELEETRASLQRNIDETKHSSELLAAELTTTKELLKKTNEEMHTMSDELVAVSENRDSLQTELVNVYKKREHTRNELKQEKTIVRTLEEELKFLESQITREKELRKSLEDELEKATESLDEINRNVLALAEELELATSRNSSLEDEREVHRQSVSEQKQISQEAQENLEDAHSLVMKLGKERESLEKRAKKLEDEMAAAKGEILRLRSQINSVKAPVEDEEKVVAGEKEKVNVQQ nrip1_sollc_protein N receptor interacting protein (NRIP1) (Tomato) protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato An amino acid sequence which is not represented in UniProt The protein is a homologue of Tobacco NPIR1 protein UniProt Q45TE3 tmvrn_nicgu TMV resistance protein N N protein protein nicgu Nicotiana glutinosa (Tobacco) MASSSSSSRWSYDVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFAIVVFSENYATSRWCLNELVKIMECKTRFKQTVIPIFYDVDPSHVRNQKESFAKAFEEHETKYKDDVEGIQRWRIALNEAANLKGSCDNRDKTDADCIRQIVDQISSKLCKISLSYLQNIVGIDTHLEKIESLLEIGINGVRIMGIWGMGGVGKTTIARAIFDTLLGRMDSSYQFDGACFLKDIKENKRGMHSLQNALLSELLREKANYNNEEDGKHQMASRLRSKKVLIVLDDIDNKDHYLEYLAGDLDWFGNGSRIIITTRDKHLIEKNDIIYEVTALPDHESIQLFKQHAFGKEVPNENFEKLSLEVVNYAKGLPLALKVWGSLLHNLRLTEWKSAIEHMKNNSYSGIIDKLKISYDGLEPKQQEMFLDIACFLRGEEKDYILQILESCHIGAEYGLRILIDKSLVFISEYNQVQMHDLIQDMGKYIVNFQKDPGERSRLWLAKEVEEVMSNNTGTMAMEAIWVSSYSSTLRFSNQAVKNMKRLRVFNMGRSSTHYAIDYLPNNLRCFVCTNYPWESFPSTFELKMLVHLQLRHNSLRHLWTETKHLPSLRRIDLSWSKRLTRTPDFTGMPNLEYVNLYQCSNLEEVHHSLGCCSKVIGLYLNDCKSLKRFPCVNVESLEYLGLRSCDSLEKLPEIYGRMKPEIQIHMQGSGIRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLKSLVSLSVSGCSKLESLPEEIGDLDNLRVFDASDTLILRPPSSIIRLNKLIILMFRGFKDGVHFEFPPVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLPELPPELNELHVDCHMALKFIHYLVTKRKKLHRVKLDDAHNDTMYNLFAYTMFQNISSMRHDISASDSLSLTVFTGQPYPEKIPSWFHHQGWDSSVSVNLPENWYIPDKFLGFAVCYSRSLIDTTAHLIPVCDDKMSRMTQKLALSECDTESSNYSEWDIHFFFVPFAGLWDTSKANGKTPNDYGIIRLSFSGEEKMYGLRLLYKEGPEVNALLQMRENSNEPTEHSTGIRRTQYNNRTSFYELING f1jyz6_sollc Autophagy-related protein 100736469 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MAKSSFKQEHDLEKRRAEAARIREKYADRIPVIVEKAEKSDIPNIDKKKYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFIDNVLPPTGAIMSAIYDEKKDDDGFLYVTYSGENTFGVLSEL f1jyz5_sollc Autophagy-related protein 100736468 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MAKSSFKLEHPLERRQAEAARIREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEEHKDEDGFLYMTYSGENTFGSF f2yhl2_sollc Autophagy-related protein protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MGKTFKDEYSYDERLTESQDIIAKYPDRVPVVAERYSKTDLPEMEKKKYLVPRDMSVGQFIHILSGRLHLAPGKALFVFVNNTLPQTTSLIETVYESSKDKDGFLYMCYSSEKTFGGHS q5i6e9_sollc Adi3 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MERIPEVRESTRQFPIGAKVAHTFSTSKKEVGIRGFRDFDLAIPIQTWKGKTSYQEEEDLMVDAGTIKRSDDSLEDSGSTSFHGASHPPEPVDTDLMRPVYVPIGQNKADGKCLVKNVSLKGPFLDDLSIRMPNVKPSPSLLSPAESLVEEPNDLGVISSPFTVPRPSQNTETSLPPDSEEKECIWDASLPPSGNVSPLSSIDSTGVVRSMSIVNSCTSTYRSDVLMSDGMLSVDRNYESTKGSIRGDSLESGKTSLSRASDSSGLSDDSNWSNITGSANKPHKGNDPRWKAILAIRARDGILGMSHFKLLKRLGCGDIGSVYLSELSGTRCYFAMKVMDKASLASRKKLTRAQTEREILQLLDHPFLPTLYTHFETDRFSCLVMEYCPGGDLHTLRQRQPGKHFSEYAARFYAAEVLLALEYLHMLGVVYRDLKPENVLVRDDGHIMLSDFDLSLRCAVSPTLIRISSDDPSKRGAAFCVQPACIEPTTVCMQPACFLPRLFPQKSKKKTPKPRADSGFQANSMPELVAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLHELLYGKTPFKGSGNRATLFNVVGQQLKFPDSPATSYASRDLIRGLLVKEPQNRLGVKRGATEIKQHPFFEGVNWALIRCSTPPEVPRPVEPDYPAKYGQVNPVGVGNTSKRVVGADAKSGGKYLDFEFF sut1 Reconstitution of Potato SUT1 Sucrose Transporter 677655 N/A 677656 unspecified role unspecified role prey prey n-terminal NubPLV tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 677656 unspecified role unspecified role bait bait c-terminal CubPLV tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3 sut1-1 Reconstitution of Tomato SUT1 Sucrose Transporter 677655 N/A 677657 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal NubPLV tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 677657 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false c-terminal CubPLV tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 3 The length of the UniProt protein Q40167 is 429 amino acids, Reinders et al state that the protein used in their study is 510 amino acids in length. sut1-sut1 Reconstitution of N terminal region of the Tomato SUT1 Sucrose Transporter and C terminal region of the Potato SUT1 Sucrose Transporter 677655 N/A 677657 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false c-terminal CubPLV tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 677656 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n-terminal CubPLV tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 8 sut1-2 Reconstitution of Tomato SUT1 Sucrose Transporter 677697 N/A 677657 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal NubPLV tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 677657 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain range range false c-terminal CubPLV tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 4 The amino acid coordinates of the N and C terminal regions of the protein used in the study are not provided. Therefore the protein is represented as two halfs with fuzzy coordinates used to represent the approximated coordinates. sut1-sut2 Reconstitution of N terminal Tomato SUT1 and C terminal Tomato SUT2 Sucrose Transporter 677697 N/A 677657 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain range range false c-terminal NubPLV tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 677699 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region range range certain certain sequence position certain false n-terminal NubPLV tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 4 The amino acid coordinates of the N and C terminal regions of the protein(s) used in the study are not provided. Therefore the protein is represented as two halfs with fuzzy coordinates used to represent the approximated coordinates. sut1-sut4 Reconstitution of N terminal Tomato SUT1 and C terminal Tomato SUT4 Sucrose Transporter 677697 N/A 677700 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region range range certain certain sequence position certain false n-terminal NubPLV tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 677657 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain range range false c-terminal CubPLV tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 4 The amino acid coordinates of the N and C terminal regions of the protein(s) used in the study are not provided. Therefore the protein is represented as two halfs with fuzzy coordinates used to represent the approximated coordinates. sut2 Reconstitution of N terminal Tomato SUT2 and C terminal Tomato SUT2 Sucrose Transporter 677697 N/A 677699 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region range range certain certain sequence position certain false n-terminal NubPLV tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 677699 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain range range false c-terminal CubPLV tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 4 The amino acid coordinates of the N and C terminal regions of the protein(s) used in the study are not provided. Therefore the protein is represented as two halfs with fuzzy coordinates used to represent the approximated coordinates. sut2-sut4 Reconstitution of N terminal Tomato SUT2 and C terminal Tomato SUT4 Sucrose Transporter 677697 N/A 677699 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain range range false c-terminal CubPLV tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 677700 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region range range certain certain sequence position certain false n-terminal NubPLV tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 4 The amino acid coordinates of the N and C terminal regions of the protein(s) used in the study are not provided. Therefore the protein is represented as two halfs with fuzzy coordinates used to represent the approximated coordinates. sut2-sut1 Reconstitution of N terminal Tomato SUT2 and C terminal Tomato SUT1 Sucrose Transporter 677697 N/A 677657 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region range range certain certain sequence position certain false n-terminal NubPLV tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 677699 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain range range false c-terminal CubPLV tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 4 The amino acid coordinates of the N and C terminal regions of the protein(s) used in the study are not provided. Therefore the protein is represented as two halfs with fuzzy coordinates used to represent the approximated coordinates. trp1-esr1 837203 n/a 837205 unspecified role unspecified role bait bait n/a 837206 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 9C trp1-etr1 837203 n/a 837205 unspecified role unspecified role bait bait n/a 837207 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 9C trp1-etr3 837203 n/a 837205 unspecified role unspecified role bait bait n/a 837208 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 9C adi3-f2yhl2-1 1275598 n/a 1275600 unspecified role unspecified role bait bait n/a 1275601 unspecified role unspecified role prey prey physical association physical association false false false 2a adi3-f2yhl2-2 1275598 n/a 1275600 unspecified role unspecified role prey prey n/a 1275601 unspecified role unspecified role bait bait physical association physical association false false false 2a and 2b f1jyz5-adi3 1275598 n/a 1275602 unspecified role unspecified role bait bait n/a 1275600 unspecified role unspecified role prey prey physical association physical association false false false 2b f1jyz6-adi3-1 1275598 n/a 1275603 unspecified role unspecified role bait bait n/a 1275600 unspecified role unspecified role prey prey physical association physical association false false false 2b adi3-f2yhl2 1275599 n/a 1275601 unspecified role unspecified role prey prey n/a 1275600 unspecified role unspecified role bait bait physical association physical association false false false text, section 3.1 tify10a-sicol1 Arabidopsis TIFY10A (JAZ1) interacts with Tomato COL1 756748 N/A 756755 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato N/A 756750 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 2b nr-sitpr1 837225 n/a 837228 unspecified role unspecified role prey prey n/a 837208 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 1A Figure S1 etr1-sitpr1-1 837225 n/a 837228 unspecified role unspecified role prey prey n/a 837207 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 1A nr-sitpr1-1 837226 n/a 837228 unspecified role unspecified role prey prey region LexA tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 837208 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figure 1F etr1-sitpr1-2 837226 n/a 837207 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 837228 unspecified role unspecified role prey prey region lexA tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figure 1F nr-sitpr1-2 837227 n/a 837228 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 837208 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Figure 10 cul4-det1 773699 n/a 773704 unspecified role unspecified role bait bait n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 773711 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false Figure 3d rbx1-det1 773699 n/a 773711 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress n/a 773705 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 3d cul4-det1-1 773702 n/a 773704 unspecified role unspecified role bait bait n/a 773711 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3e mfp1-maf1-1 546818 N/A 546821 unspecified role unspecified role prey prey N/A 546822 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1D maf1-mfp1 546818 N/A 546821 unspecified role unspecified role bait bait N/A 546822 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1D mfp1-maf1 546819 N/A 546821 unspecified role unspecified role prey prey N/A 546822 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1A mfp1-maf1-2 546820 N/A 546821 unspecified role unspecified role prey prey n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) N/A 546822 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false 1E The UniProt entry for protein MFP1 is 697 amino acids in length. The construct used in the paper reports thet the MFP1 protein consisted of residues 126 to 717 amino acids. The UniProt protein sequence was used to delimit the binding region of MFP1 to MAF1. n-nrip1 N protein (Tobacco) interacts with NPIR1 homologue from Tomato 762147 N/A 762152 unspecified role unspecified role prey prey N/A 762149 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false The TIR region coordinates are taken from the rerefence provided by the authors , Dinesh-kumar et al (2000). Structure-function analysis of the tobacco mosaic virus resistance gene N. PMID:11121079. Please note therse coordinates differ from the coordinates of the UniProt record.