IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sato-2005-1 Transient homodimer interactions studied using the electron self-exchange reaction. in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Sato K., Crowley PB., Dennison C. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Electron transfer self-exchange (ESE) is a simple reaction exhibited by redox proteins that provides a measure of their electron transfer (ET) capabilities. An essential step in ESE is homodimer formation giving rise to transient protein interactions on the submillisecond time scale. fig 2A, table 1, fig 3 crowley@itqb.unl.pt J. Biol. Chem. (0021-9258) 2005 plas_dryca Plastocyanin PETE protein protein dryca Dryopteris crassirhizoma (Thick stemmed wood fern) AKVEVGDEVGNFKFYPDSITVSAGEAVEFTLVGETGHNIVFDIPAGAPGTVASELKAASMDENDLLSEDEPSFKAKVSTPGTYTFYCTPHKSANMKGTLTVK plas_ulvpe Plastocyanin PETE protein protein ulvpe Ulva pertusa (Sea lettuce) AQIVKLGGDDGSLAFVPSKISVAAGEAIEFVNNAGFPHNIVFDEDAVPAGVDADAISYDDYLNSKGETVVRKLSTPGVYGVYCEPHAGAGMKMTITVQ plas_rumob Plastocyanin PETE protein protein rumob Rumex obtusifolius (Bitter dock) IEIKLGGDDGALAFVPGSFTVAAGEKIVFKNNAGFPHNIVFDEDEVPAGVDASKISMSEEDLLNAPGETYAVTLSEKGTYSFYCSPHQGAGMVGKVTVQ plas_anava Plastocyanin petE protein protein anava Anabaena variabilis ETYTVKLGSDKGLLVFEPAKLTIKPGDTVEFLNNKVPPHNVVFDAALNPAKSADLAKSLSHKQLLMSPGQSTSTTFPADAPAGEYTFYCEPHRGAGMVGKITVAG pete-pete-1 Transient homodimer interactions of D. crassirhizhoma Plastocyanin detected by electron self-exchange reaction 208018 N/A 208019 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 208019 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) physical association physical association false false false The electron self-exchange rate of D. Crassirhizoma plastocyanin is 0.12 M-1 s-1 and 3.5 M-1 s-1 at the respective Ionic Strength I = 0.03 M, I = 2.03 M. pete-pete-2 Transient homodimer interactions of U. pertusa Plastocyanin detected by electron self-exchange reaction 208018 N/A 208020 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 208020 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) physical association physical association false false false The electron self-exchange rate of U. pertusa plastocyanin is 1.7 M-1 s-1 and 35 M-1 s-1 at the respective Ionic Strength I = 0.03 M, I = 2.03 M. pete-pete-3 Transient homodimer interactions of Spinach Plastocyanin detected by electron self-exchange reaction 208018 N/A 208021 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 208021 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) physical association physical association false false false The electron self-exchange rate of Spinach plastocyanin is 0.048 M-1 s-1 and 9.1 M-1 s-1 at the respective Ionic Strength I = 0.03 M, I = 2.03 M. pete-pete-4 Transient homodimer interactions of A. variabilis Plastocyanin detected by electron self-exchange reaction 208018 N/A 208022 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) N/A 208022 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) physical association physical association false false false The electron self-exchange rate of A. variabilis plastocyanin is 17 M-1 s-1 and 34 M-1 s-1 at the respective Ionic Strength I = 0.01 M, I = 2.01 M.