mpidb The Microbial Protein Interaction Database kirsch-2012-3 Essential amino acid residues of BioY reveal that dimers are the functional S unit of the Rhodobacter capsulatus biotin transporter. ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds weight by comassie molecular weight estimation by coomasie staining weight by comassie Kirsch F., Frielingsdorf S., Pohlmann A., Ziomkowska J., Herrmann A., Eitinger T. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation q5ln73_ruepo Biotin transporter SPO3339 protein protein ruepo Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) Silicibacter pomeroyi MKQTTEAVVAGARAPALSGQILRVAAGIAILTLSARVQVPFWPVPMTLQVAAVMALAALYGMRLGTATLAGYLAVGALGLPVFAGTPEKGLGLAYMLGGTGGYLVGFLVASALVGFAADRLHRLALWPAMLLGLAVIYALGLAWLAQFVPADKLLAYGMTPFVAGDLVKVTLAALLVTKLPQGWAERLRGGARHG a3u2l6_psebh Biotin transporter OB2597_04098 protein protein oceanicola batsensis htcc2597 Oceanicola batsensis HTCC2597 MSQASTARVLTEAFGPTEGAALRLKQAALVVAGIALLAVCAKIKLPVPGSPVAVGMGTFAVLGIGAAYGAKLGLTTIMGYMLIGLLGFDIFQSSTAELNGVDYMMGSTGGYLLGYVLATVLLGALAQRGWDRSVLWMALAMLLGNILLYIPGLGWLGMLYGWDKPILEWGLTPFIIGDLLKLALAALILPAAWKLIGRARG q6n716_rhopa Biotin transporter RPA2447 protein protein rhopa Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) MPLGSSAPPRMGGHTALAAALWPRRTDGFSAWLRMAVLIAFGSVLLALSAKVNLPLPLVPMTLQTLMVVLIGAAYGARLGAATVLAYLAEGAAGLPVFAGPVGGLAPLLGPTAGYLAGFVVAAVLVGWCADRGFDRSVAKLFAAMLAGHLAILTLGFAWLAFGLHLGLAKAWWVGVVPFLAGSLVKSALGAALLPAVRRIVDRQR a9cjy4_agrfc Biotin transporter bioY Atu0749 protein protein agrt5 Agrobacterium tumefaciens (strain C58 / ATCC 33970) Agrobacterium tumefaciens (strain C58) MTTRDLVLISLFSAIIIALGLLPPITLGFIPVPITAQSLGVMLAGVVLGAKRGTLAVLLTILIAGIGLPVLSGGRGGLSIFTTPTTGFLIGWIAAVFVTGFLSEKFVHSGQSALAQGVGFFVASLIGGVVVLYAFGITYLALVVGLGFEKAFIGSLLFIPGDALKAVLAALAGRAVMAGYPLLPQRA bioy_rhocb Biotin transporter BioY bioY Biotin ECF transporter S component BioY RCAP_rcc03249 protein protein rhocb Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) MERNVTLIGLFAALIVALGFVPAIPLGFGVPITLQSLGVMLAGAVLGSWRGALAVLLVQALVAIGLPVLAGGRGGLGIFVGPTAGFLIGWLPAAFVTGLIVERLRRVPVALAAGIGATLGGIIIMYALGILGFWLVKNAGLKPEDAPISLWAATAIMAPFIPGDLVKVVVTGLVARTIAQYRPSALLARG a3tzi7_psebh Biotin transporter OB2597_17167 protein protein oceanicola batsensis htcc2597 Oceanicola batsensis HTCC2597 MTREISIILVGTILLTISAKIVVPFYPVPMSTQTLVVLGLGLFLGPVRSSLVVVTYLFEGLLGLPVFAGTPPAPAGLAYIAGPTGGYLVGFALAAAAAGWVVQALQGLWPSFRASVAVFSGSILMYCAGLFWLGGFVGYGEKLLNAGLYPFLIGDLTKATIAVVLYSAYHNRRAV q89m96_bradu Biotin transporter blr4297 protein protein braja Bradyrhizobium japonicum (strain USDA 110) MWPTRPGETVGALRAFVLVALGTALLALSAKVNLPLPYVPMTLQTLVVLMIGAAYGWRLGSATMIAYLAEGALGLPVFAGPVGGIAPLVGPTAGYLFGFIAAAFVTGWLAERGWDRSVVLLFAAMAVGHIVILAAGFGWLAFGLGLGASKAWQVGLAPFIAASLVKNALGATLMPAARRIVDRRG q166h5_rosdo Biotin transporter bioY RD1_2561 protein protein rosdo Roseobacter denitrificans (strain ATCC 33942 / OCh 114) MQMSASHSVLADQFGPAAGTARRIKQAVLVVLGIAVLAVAANIKVPVPGSPVLMNMGTFAVLTIGAAYGARLGLTTIMGYMIIGALGFDIFQSSTAELNGIEYMMGSTGGYLVGYVMATVLLGALAQRGWDRSMVWMAVAMLIGNIVLYVPGLLWLGQLYGWDQPILAWGLTPFLLGDALKLLLAAILLPLVWKLVGDARR q92ri3_rhime Biotin transporter bioB SMc00964 protein protein sinorhizobium melilo Rhizobium meliloti (strain 1021) (Ensifer meliloti) Sinorhizobium meliloti Ensifer meliloti MNTRDLVLVALFTAIIVVLGLVPPITLGFIPVPITAQSMGVMLAGCIIGAKRGALAFLLLVLLVAIGLPVLSGGRGGLAVLAGPSGGFIFGWAVAAFVTGLIAERFVKPATSEARQFAGFFLASVLGGIVVLYGIGVPWLSAVTGTPLAAAATGSLVFIPGDLLKAAIATLAARAVYAGYPLLPARV q5lr30_ruepo Biotin transporter SPO2302 protein protein ruepo Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) Silicibacter pomeroyi MSMTVLADAIGPREGTARLAKQAVLVVLGIAALAIAAKIKVPMWPVPITMGTFAVLTLGTAYGARLGLVTMMGYLLVGALGFDVFATSSAEKFGLTYMMGGTGGYLVGYLMATVLLGALAARGWDRSFAKMALALVLANVLIYVPGLLWLGQLYGWDKPILQWGLTPFLVGDALKLVLAAVLIPGLWKLVGNARG bioy-bioy-2 1339896 not-defined-356585247 1339899 unspecified role unspecified role unspecified role unspecified role c-terminal D5ARG8-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal D5ARG8-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 q5ln73 1339896 n/a 1339900 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 a3u2l6 1339896 n/a 1339901 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 q6n716 1339896 n/a 1339902 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 bioy-3 1339896 n/a 1339903 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 q89m96 1339896 n/a 1339904 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 bioy-3 1339896 n/a 1339905 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 biob-1 1339896 n/a 1339906 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 q5lr30 1339896 n/a 1339907 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 a3tzi7 1339896 n/a 1339908 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ huang-2010-3 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Huang CS., Sadre-Bazzaz K., Shen Y., Deng B., Zhou ZH., Tong L. DIP original experiment: DIP-219414X Nature 2010 IMEx Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase. Huang CS., Sadre-Bazzaz K., Shen Y., Deng B., Zhou ZH., Tong L. Only protein-protein interactions imex curation huang-2010-8 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Huang CS., Sadre-Bazzaz K., Shen Y., Deng B., Zhou ZH., Tong L. DIP original experiment: DIP-219415X Nature 2010 IMEx Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase. Huang CS., Sadre-Bazzaz K., Shen Y., Deng B., Zhou ZH., Tong L. Only protein-protein interactions imex curation huang-2010-11 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Huang CS., Sadre-Bazzaz K., Shen Y., Deng B., Zhou ZH., Tong L. DIP original experiment: DIP-219416X Nature 2010 IMEx Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase. Huang CS., Sadre-Bazzaz K., Shen Y., Deng B., Zhou ZH., Tong L. Only protein-protein interactions imex curation pccb_rosdo Propionyl-CoA carboxylase beta chain pccB RD1_2028 protein protein rosdo Roseobacter denitrificans (strain ATCC 33942 / OCh 114) MKDILEQLEDRRAAARLGGGQKRIDAQHGRGKLTARERVDLLLDEGSFEEFDMFVTHRCTDFNMQDQKPAGDGVVTGWGTINGRVVYVFSQDFTVLGGSVSETHSKKICKIMDMAMQNGAPVIGINDSGGARIQEGVDSLAGYGEVFQRNIMASGVVPQISMIMGPCAGGAVYSPAMTDFIFMVKDSSYMFVTGPDVVKTVTNEQVSAEELGGATTHTRKSSVADAAFENDVEALAEVRRLVDFLPLNNREKPPVRPFFDDPDRIEPSLDTLVPDNPNTPYDMKELIHKLADEGDFYEIQEEFAKNIITGFIRLEGRTVGVVANQPLVLAGCLDIDSSRKAARFVRFCDAFEIPLLTLIDVPGFLPGTSQEYGGVIKHGAKLLYAYGEATVPMVTVITRKAYGGAYVVMSSKHLRADFNYAWPTAEVAVMGAKGATEIIHRGDLGDPEKIAQHTADYEERFANPFVASERGFVDEVIQPRSTRKRVARAFASLRNKSVQMPWKKHDNIPL pcca_ruepo Propionyl-CoA carboxylase alpha chain pccA SPO1101 protein protein ruepo Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) Silicibacter pomeroyi MFNKILIANRGEIACRVIKTARKMGISTVAIYSDADKQALHVQMADEAVHIGPPPANQSYIVIDKVMAAIRATGAQAVHPGYGFLSENSKFAEALEAEGVIFVGPPKGAIEAMGDKITSKKIAQEANVSTVPGYMGLIEDADEAVKISNQIGYPVMIKASAGGGGKGMRIAWNDQEAREGFQSSKNEAANSFGDDRIFIEKFVTQPRHIEIQVLCDSHGNGIYLGERECSIQRRNQKVVEEAPSPFLDEATRRAMGEQAVALAKAVGYASAGTVEFIVDGQKNFYFLEMNTRLQVEHPVTELITGVDLVEQMIRVAAGEPLSITQGDVKLTGWAIENRLYAEDPYRGFLPSIGRLTRYRPPAETAAGPLLVNGKWQGDAPSGEAAVRNDTGVYEGGEISMYYDPMIAKLCTWAPTRAAAIEAMRIALDSFEVEGIGHNLPFLSAVMDHPKFISGDMTTAFIAEEYPEGFEGVNLPETDLRRVAAAAAAMHRVAEIRRTRVSGRMDNHERRVGTEWVVTLQGADFPVTIAADHDGSTVSFDDGSSMRVTSDWTPGDQLANLMVDGAPLVLKVGKISGGFRIRTRGADLKVHVRTPRQAELARLMPEKLPPDTSKMLLCPMPGLIVKVDVEVGQEVQEGQALCTIEAMKMENILRAEKKGVVAKINASAGNSLAVDDVIMEFE E9621118EF90D008 pccb-rppcc_alpha-1 3212814 N/A 3212823 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3212824 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false pccb-rppcc_alpha-2 3212819 N/A 3212823 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3212824 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false pccb-rppcc_alpha-3 3212822 N/A 3212823 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3212824 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false