IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ koeppel-2004-10 Identification and characterization of PS-GAP as a novel regulator of caspase-activated PAK-2. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Koeppel M.A., McCarthy C.C., Moertl E., Jakobi R. rjakobi@kcumb.edu email address is obsolete. This experiment relates to a negative interaction. pak2 origin inferred from author's email. rjakobi@kcumb.edu; jakobir@csr.nih.gov J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation koeppel-2004-7 Identification and characterization of PS-GAP as a novel regulator of caspase-activated PAK-2. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Koeppel M.A., McCarthy C.C., Moertl E., Jakobi R. rjakobi@kcumb.edu email address is obsolete. This experiment relates to a negative interaction. pak2 origin inferred from author's email. rjakobi@kcumb.edu; jakobir@csr.nih.gov J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation koeppel-2004-8 Identification and characterization of PS-GAP as a novel regulator of caspase-activated PAK-2. in vitro In vitro pull down pull down autoradiography autoradiography Koeppel M.A., McCarthy C.C., Moertl E., Jakobi R. rjakobi@kcumb.edu email address is obsolete. This experiment relates to a negative interaction. pak2 origin inferred from author's email. rjakobi@kcumb.edu; jakobir@csr.nih.gov J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation koeppel-2004-9 Identification and characterization of PS-GAP as a novel regulator of caspase-activated PAK-2. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Koeppel M.A., McCarthy C.C., Moertl E., Jakobi R. rjakobi@kcumb.edu email address is obsolete. This experiment relates to a negative interaction. pak2 origin inferred from author's email. rjakobi@kcumb.edu; jakobir@csr.nih.gov J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation pak2_rabit Serine/threonine-protein kinase PAK 2 PAK2 Gamma-PAK p21-activated kinase 2 p21-activated protein kinase I protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGAPALNTKVSETSAVVTEEDDDDEEAAPPVIAPRPDHTKSIYTRSVIDPIPAPVGDSHVDSGAKSSDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR q6y5d8-1 Rho GTPase-activating protein 10 PS-GAP-a PSGAP-m Arhgap10 PH and SH3 domain-containing rhoGAP protein Rho-type GTPase-activating protein 10 protein protein mouse Mus musculus Mouse MGLQPLEFSDCYLDSPWFRERIRAHEAELERTNKFIKELIKDGKNLISATKSLSAAQRKFAHSLRDFKFEFIGDAETDDERCIDASLREFSNFLKNLEEQREIMALSVTETLIKPLEKFRKEQLGAVKEEKKKFDKETEKNYSLIDKHLTLSARKKDSHLQEADLQVEQNRQHFYELSLEYVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELSKDFNHYKMELQINIQNTRNRFEGTRSEVEELMNKIRQNPKDQKRASQFTAEGYLYVQEKRPAPFGSSWVKHYCMYRKTAKKFNMIPFEHRSGGKLGDGEAFFLKECTKRHMDSTDRRFCFDIEAADRPGVPLTVQAFSEEERKQWLEALGGKEALFHTFNRAIVPRPEGGAQLDKMGFTILRKCISAVETRGINDQGLYRVVGVSSKVQRLLSMLMDVKMCNELDLENSADWEVKTVTSALKQYLRSLPEPLMTYELHRDFIVPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSSHSKQNLMTVANLGVVFGPTLMRPQEETVAAIMDLKFQNIVVEILIENHEKIFRTSPDTTFAEPTCLSASPPNAPPRQSKRQGQRTKRPVAVYNLCLELEEGDSPSPLKEDPPSSSQDSLSTPSPTTSAAHGPPGLDGNHLAADGGSCGDATATTPSQTRPSMVQWLNMQSPTTPSSNPAGTPPSPRMSPFPLSPAASIVDKLPECVINRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQNYVKLL rhg10_mouse Rho GTPase-activating protein 10 Arhgap10 PH and SH3 domain-containing rhoGAP protein Rho-type GTPase-activating protein 10 protein protein mouse Mus musculus Mouse MGLQPLEFSDCYLDSPWFRERIRAHEAELERTNKFIKELIKDGKNLISATKSLSAAQRKFAHSLRDFKFEFIGDAETDDERCIDASLREFSNFLKNLEEQREIMALSVTETLIKPLEKFRKEQLGAVKEEKKKFDKETEKNYSLIDKHLTLSARKKDSHLQEADLQVEQNRQHFYELSLEYVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELSKDFNHYKMELQINIQNTRNRFEGTRSEVEELMNKIRQNPKDQKRASQFTAEGYLYVQEKRPAPFGSSWVKHYCMYRKTAKKFNMIPFEHRSGGKLGDGEAFFLKECTKRHMDSTDRRFCFDIEAADRPGVPLTVQAFSEEERKQWLEALGGKEALFHTFNRAIVPRPEGGAQLDKMGFTILRKCISAVETRGINDQGLYRVVGVSSKVQRLLSMLMDVKMCNELDLENSADWEVKTVTSALKQYLRSLPEPLMTYELHRDFIVPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSSHSKQNLMTVANLGVVFGPTLMRPQEETVAAIMDLKFQNIVVEILIENHEKIFRTSPDTTFAEPTCLSASPPNAPPRQSKRQGQRTKRPVAVYNLCLELEEGDSPSPLKEDPPSSSQDSLSTPSPTTSAAHGPPGLDGNHLAADGGSCGDATATTPSQTRPSMVQWLNMQSPTTPSSNPAGTPPSPRMSPFPLSPAASIVDKLPECVINRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQNYVKLL arhgap10-pak2 1180683 n/a 1180687 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1180688 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false true 5b The interaction does not occur under these experimental conditions. pak2-arhgap10-5 1180683 n/a 1180687 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1180688 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false true 5c The interaction didin't happen when the full-length form of pak2 was used. pak2-pak2-8 1180684 n/a 1180689 unspecified role unspecified role prey prey c-terminal fragment sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1180687 unspecified role unspecified role bait bait physical association physical association false false true 1a The interaction does not occur under these experimental conditions. pak2-arhgap 1180685 n/a 1180689 unspecified role unspecified role prey prey cell lysate cell lysate [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 1180687 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction false false true 1b The interaction does not occur under these experimental conditions. pak2-arhgap10-4 1180686 n/a 1180688 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1180687 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false true 5a Interaction didn't happen with the full-lenght version of pak2.