DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ gimenez_ibanez-2014-1 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259789X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions imex curation gimenez_ibanez-2014-2 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259791X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions imex curation gimenez_ibanez-2014-3 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259800X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions imex curation gimenez_ibanez-2014-4 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259795X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions imex curation gimenez_ibanez-2014-5 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259796X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions imex curation gimenez_ibanez-2014-6 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259793X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions imex curation gimenez_ibanez-2014-7 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259798X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions imex curation gimenez_ibanez-2014-8 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259790X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions imex curation gimenez_ibanez-2014-9 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259794X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions imex curation gimenez_ibanez-2014-10 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259792X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions imex curation gimenez_ibanez-2014-11 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259797X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions imex curation gimenez_ibanez-2014-12 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. DIP original experiment: DIP-259799X PLoS biology 2014 IMEx The bacterial effector HopX1 targets JAZ transcriptional repressors to activate jasmonate signaling and promote infection in Arabidopsis. Gimenez-Ibanez S., Boter M., Fernández-Barbero G., Chini A., Rathjen JP., Solano R. Only protein-protein interactions imex curation ti10a_arath Protein TIFY 10A TIFY10A JAZ1 At1g19180 T29M8.5 Jasmonate ZIM domain-containing protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSMECSEFVGSRRFTGKKPSFSQTCSRLSQYLKENGSFGDLSLGMACKPDVNGTLGNSRQPTTTMSLFPCEASNMDSMVQDVKPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKPESQTAPLTIFYAGQVIVFNDFSAEKAKEVINLASKGTANSLAKNQTDIRSNIATIANQVPHPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASSNPQTTGNMSWLGLAAEI q83ym6_pseaj avrPphE hopX1 ALP03_100453 protein protein pseaj Pseudomonas amygdali pv. tabaci Pseudomonas syringae pv. tabaci MRIHSAGHSLPAPGPSVETTEKAVQSSSAQNPASCSSQTERPEAGSTQVRPNYPYSSVKTRLPPVSSTGQAISDTPSSLPGYLLLRRLDRRPLDEDSIKALVPADEAVREARRALPFGRGNIDVDAQRTHLQSGARAVAAKRLRKDAERAGHEPMPGNDEMNWHVLVAMSGQVFGAGNCGEHARIASFAYGALAQESGRSPREKIHLAEQPGKDHVWAETDNSSAGSSPIVMDPWSNGAAILAEDSRFAKDRSAVERTYSFTLAMAAEAGKVTRETAENVLTHTTSRLQKRLADQLPNVSPLEGGRYQQEKSVLDEAFARRVSDKLNSDDPRRALQMEIEAVGVAMSLGAEGVKTVARQAPKVVRQARSVASSKGMPPRR tif6b_arath Protein TIFY 6B TIFY6B JAI3 JAZ3 MEB5.8 At3g17860 Jasmonate ZIM domain-containing protein 3 Protein JASMONATE INSENSITIVE 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLGSKNSPITVKEETSESSRDSAPNRGMNWSFSNKVSASSSQFLSFRPTQEDRHRKSGNYHLPHSGSFMPSSVADVYDSTRKAPYSSVQGVRMFPNSNQHEETNAVSMSMPGFQSHHYAPGGRSFMNNNNNSQPLVGVPIMAPPISILPPPGSIVGTTDIRSSSKPIGSPAQLTIFYAGSVCVYDDISPEKAKAIMLLAGNGSSMPQVFSPPQTHQQVVHHTRASVDSSAMPPSFMPTISYLSPEAGSSTNGLGATKATRGLTSTYHNNQANGSNINCPVPVSCSTNVMAPTVALPLARKASLARFLEKRKERVTSVSPYCLDKKSSTDCRRSMSECISSSLSSAT ti11a_arath Protein TIFY 11A TIFY11A JAZ5 Jasmonate ZIM domain-containing protein 5 F1L3.3 F28G4.16 At1g17380 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSNENAKAQAPEKSDFTRRCSLLSRYLKEKGSFGNIDLGLYRKPDSSLALPGKFDPPGKQNAMHKAGHSKGEPSTSSGGKVKDVADLSESQPGSSQLTIFFGGKVLVYNEFPVDKAKEIMEVAKQAKPVTEINIQTPINDENNNNKSSMVLPDLNEPTDNNHLTKEQQQQQEQNQIVERIARRASLHRFFAKRKDRAVARAPYQVNQNAGHHRYPPKPEIVTGQPLEAGQSSQRPPDNAIGQTMAHIKSDGDKDDIMKIEEGQSSKDLDLRL ti11b_arath Protein TIFY 11B TIFY11B JAZ6 Jasmonate ZIM domain-containing protein 6 T10D10.8 At1g72450 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTGQAPEKSNFSQRCSLLSRYLKEKGSFGNINMGLARKSDLELAGKFDLKGQQNVIKKVETSETRPFKLIQKFSIGEASTSTEDKAIYIDLSEPAKVAPESGNSQLTIFFGGKVMVFNEFPEDKAKEIMEVAKEANHVAVDSKNSQSHMNLDKSNVVIPDLNEPTSSGNNEDQETGQQHQVVERIARRASLHRFFAKRKDRAVARAPYQVNQHGSHLPPKPEMVAPSIKSGQSSQHIATPPKPKAHNHMPMEVDKKEGQSSKNLELKL tif5b_arath Protein TIFY 5B TIFY 5B JAZ7 Jasmonate ZIM domain-containing protein 7 T31E10.6 At2g34600 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIIIIKNCDKPLLNFKEMEMQTKCDLELRLLTSSYDSDFHSSLDESSSSEISQPKQESQILTIFYNGHMCVSSDLTHLEANAILSLASRDVEEKSLSLRSSDGSDPPTIPNNSTRFHYQKASMKRSLHSFLQKRSLRIQATSPYHRYR tif7_arath Protein TIFY 7 TIFY7 JAZ9 F5A18.12 At1g70700 Jasmonate ZIM domain-containing protein 9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLSDKQYLSNNVKHEVNDDAVEERGLSTKAAREWGKSKVFATSSFMPSSDFQEAKAFPGAYQWGSVSAANVFRRCQFGGAFQNATPLLLGGSVPLPTHPSLVPRVASSGSSPQLTIFYGGTISVFNDISPDKAQAIMLCAGNGLKGETGDSKPVREAERMYGKQIHNTAATSSSSATHTDNFSRCRDTPVAATNAMSMIESFNAAPRNMIPSVPQARKASLARFLEKRKERLMSAMPYKKMLLDLSTGESSGMNYSSTSPT ti10b_arath Protein TIFY 10B TIFY10B JAZ2 F9E10.20 F25A4.8 At1g74950 Jasmonate ZIM domain-containing protein 2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSFSAECWDFSGRKPSFSQTCTRLSRYLKEKGSFGDLSLGMTCKPDVNGGSRQPTMMNLFPCEASGMDSSAGQEDIKPKTMFPRQSSFSSSSSSGTKEDVQMIKETTKSVKPESQSAPLTIFYGGRVMVFDDFSAEKAKEVIDLANKGSAKSFTCFTAEVNNNHSAYSQKEIASSPNPVCSPAKTAAQEPIQPNPASLACELPIARRASLHRFLEKRKDRITSKAPYQIDGSAEASSKPTNPAWLSSR tif6a_arath Protein TIFY 6A TIFY6A JAZ4 Jasmonate ZIM domain-containing protein 4 T1N15.11 At1g48500 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDFLGLGSKLSPITVKEETNEDSAPSRGMMDWSFSSKVGSGPQFLSFGTSQQETRVNTVNDHLLSSAAMDQNQRTYFSSLQEDRVFPGSSQQDQTTITVSMSEPNYINSFINHQHLGGSPIMAPPVSVFPAPTTIRSSSKPLPPQLTIFYAGSVLVYQDIAPEKAQAIMLLAGNGPHAKPVSQPKPQKLVHHSLPTTDPPTMPPSFLPSISYIVSETRSSGSNGVTGLGPTKTKASLASTRNNQTAAFSMAPTVGLPQTRKASLARFLEKRKERVINVSPYYVDNKSSIDCRTLMSECVSCPPAHHLH tif5a_arath Protein TIFY 5A TIFY5A JAZ8 Jasmonate ZIM domain-containing protein 8 T2H7 At1g30135 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKLQQNCDLELRLFPTSYDSDSSDTTSVVESTSSGNPQPNEESQRITIFYNGKMCFSSDVTHLQARSIISIASREMKTKSSSNGSDPPNKSTSFHHNQLPNPKASMKKSLQSFLQKRKIRIQATSPYHSRR tif9_arath Protein TIFY 9 TIFY9 JAS1 JAZ10 Protein JASMONATE-ASSOCIATED 1 Jasmonate ZIM domain-containing protein 10 Protein JAZ10 T31B5.40 At5g13220 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKATIELDFLGLEKKQTNNAPKPKFQKFLDRRRSFRDIQGAISKIDPEIIKSLLASTGNNSDSSAKSRSVPSTPREDQPQIPISPVHASLARSSTELVSGTVPMTIFYNGSVSVFQVSRNKAGEIMKVANEAASKKDESSMETDLSVILPTTLRPKLFGQNLEGDLPIARRKSLQRFLEKRKERLVSTSPYYPTSA tify10a-avrpphe-1 3263064 N/A 3263076 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3263077 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false tify6b-avrpphe-1 3263065 N/A 3263078 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3263077 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false tify11a-avrpphe-1 3263066 N/A 3263079 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe Nicotiana benthamiana N/A 3263077 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false tify11b-avrpphe-1 3263067 N/A 3263080 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3263077 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false tify 5b-avrpphe-1 3263068 n/a 3263081 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3263077 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false tify11a-avrpphe-2 3263069 N/A 3263079 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3263077 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false tify7-avrpphe-1 3263070 N/A 3263082 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3263077 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false tify10b-avrpphe-1 3263071 N/A 3263083 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3263077 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false tify11a-avrpphe-3 3263072 N/A 3263079 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 92-163 Region 92-163 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3263077 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false tify6a-avrpphe-1 3263073 N/A 3263084 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3263077 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false tify5a-avrpphe-1 3263074 N/A 3263085 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3263077 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false tify9-avrpphe-1 3263075 N/A 3263086 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3263077 unspecified role unspecified role prey prey Q83YM6:p.Cys179Ala C179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false