mpidb The Microbial Protein Interaction Database lu-1997a-1 Interactions of the components of the general secretion pathway: role of Pseudomonas aeruginosa type IV pilin subunits in complex formation and extracellular protein secretion. in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Lu H.M., Motley S.T., Lory S. Actual strain used = PAK BS3 cross-linking Mol. Microbiol. (0950-382X) 1997 Only protein-protein interactions imex curation k0xq02_pseai A161_15170 protein protein pseudomonas aeruginosa pao579 Pseudomonas aeruginosa PAO579 MQRRQQSGFTLIEIMVVVVILGILAALVVPQVMSRPDQAKVTVAKGDIKAIAAALDMYKLDNFAYPSTQQGLEALVKKPTGNPQPKNWNKDGYLKKLPVDPWGNPYQYLAPGTKGPFDLYSLGADGKEGGSDNDADIGNWDN The sequence has been withdrawn from uniprot. fmpa_pseai Fimbrial protein pilA fimA Pilin protein protein pseai Pseudomonas aeruginosa MKAQKGFTLIELMIVVAIIGILAAIAIPQYQNYVARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR k1ct21_pseai xcpW PABE177_1638 protein protein pseudomonas aeruginosa atcc 700888 Pseudomonas aeruginosa ATCC 700888 MRLQRGFTLLELLIAIAIFALLALATYRMFDSVMQTDQATRVQEQRMRELVRAMGALERDLTQAVERPVRDELGDNRGAFLSEGENDQIVEFTRGGWRNPLGQARSRLQRVRWSLSGETLERRYWLVLDRAQDSKPRVQQVLDGVTALSWRFLDKEHNWQGHWPTDEGSEEERLESLPLAVEMTLEHRHYGKLVRVWRLLDPPLKQDQPQGQPGGENGENGEGGVPQPPEGMPGAPE The sequence has been withdrawn from uniprot. k1cif5_pseai xcpV PABE171_1896 protein protein pseudomonas aeruginosa atcc 14886 pseudomonas aeruginosa atcc 14886 MKRARGFTLLEVLVALAIFAMVAASVLSASARSLQNASRLEDKTLAMWIADNRLNELQLEQTPPSSGRNQGELEFAGRRWEWRTQVDSTAEQDMRRVIVWVAAKPLGRERGSIEERAAARLVGFLGSQP The sequence has been withdrawn from uniprot. k1dm76_pseai xcpU PABE173_2250 protein protein pseudomonas aeruginosa atcc 25324 Pseudomonas aeruginosa ATCC 25324 MRASRGFTLIELMVVMVIISVLIGLAVLSTGFASTSRELDSEAERLAGLIGVLTDEAVLDNREYGLRLERDAYQVLRYDEAKARWLPVARDSHRLPEWAELTFELDGQPLVLAGSKGEKEQKKGTDQPQLLILSSGELSPFRLRLAERGPEGRALSLSSDGFRLPRVEVARR The sequence has been withdrawn from uniprot. gspg_pseae Type II secretion system core protein G xcpT pddA PA3101 General secretion pathway protein G PilD-dependent protein PddA protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MQRRQQSGFTLIEIMVVVVILGILAALVVPQVMSRPDQAKVTVAKGDIKAIAAALDMYKLDNFAYPSTQQGLEALVKKPTGNPQPKNWNKDGYLKKLPVDPWGNPYQYLAPGTKGPFDLYSLGADGKEGGSDNDADIGNWDN k0xq02-xcpt 1340437 n/a 1340438 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1118973704 1340439 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7 xcpt-xcpw-2 1340437 n/a 1340440 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1340438 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7 k0xq02-xcpv 1340437 n/a 1340438 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1340441 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7 k0xq02-xcpu 1340437 n/a 1340438 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1340442 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7 xcpu-xcpu 1340437 n/a 1340442 unspecified role unspecified role prey prey n/a 1340442 unspecified role unspecified role bait bait physical association physical association false false false Fig.1 pila-xcpu-1 1340437 n/a 1340442 unspecified role unspecified role prey prey not-defined-514846477 1340439 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4D pila-pila-3 1340437 n/a 1340439 unspecified role unspecified role prey prey not-defined-2044749309 1340439 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4B pila-xcpw 1340437 n/a 1340440 unspecified role unspecified role prey prey not-defined-2044749309 1340439 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4B pila-xcpt-1 1340437 not-defined-1844721368 1340443 unspecified role unspecified role prey prey not-defined-1916384665 1340439 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4A, 4B xcpt-xcpt 1340437 not-defined-1844721368 1340443 unspecified role unspecified role neutral component neutral component n/a 1340443 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig. 5 IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ smakowska_luzan-2018-4 arath-seedling Arabidopsis thaliana seedling anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Smakowska-Luzan E., Mott GA., Parys K., Stegmann M., Howton TC., Layeghifard M., Neuhold J., Lehner A., Kong J., Grünwald K., Weinberger N., Satbhai SB., Mayer D., Busch W., Madalinski M., Stolt-Bergner P., Provart NJ., Mukhtar MS., Zipfel C., Desveaux D., Guttman DS., Belkhadir Y. 2017-11-28: Submitted by A Mott, university of Toronto, Canada The data set provided in this publication is extended in "To be confirmed" (Mott GA. et al., Scientific Reports, 2018, PMID:unassigned1716). Please see that entry in our database for further details and extended interactions. youssef.belkhadir@gmi.oeaw.ac.at,david.guttman@utoronto.ca,darrell.desveaux@utoronto.ca Nature 2018 Only protein-protein interactions imex curation imex curation wurtele-2001-1 How the Pseudomonas aeruginosa ExoS toxin downregulates Rac. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wurtele M., Wolf E., Pederson KJ., Buchwald G., Ahmadian MR., Barbieri JT., Wittinghofer A. PDBe - Data obtained from the Protein Data Bank Europe Nat. Struct. Biol. (1072-8368) 2001 thibault-2009-1 Anti-activator ExsD forms a 1:1 complex with ExsA to inhibit transcription of type III secretion operons. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa autoradiography autoradiography Thibault J., Faudry E., Ebel C., Attree I., Elsen S. sylvie.elsen@cea.fr J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation thibault-2009-3 Anti-activator ExsD forms a 1:1 complex with ExsA to inhibit transcription of type III secretion operons. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Thibault J., Faudry E., Ebel C., Attree I., Elsen S. sylvie.elsen@cea.fr J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation thibault-2009-2 Anti-activator ExsD forms a 1:1 complex with ExsA to inhibit transcription of type III secretion operons. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column anti tag western anti tag western blot anti tag western Thibault J., Faudry E., Ebel C., Attree I., Elsen S. sylvie.elsen@cea.fr J. Biol. Chem. (0021-9258) 2009 Only protein-protein interactions imex curation gutsche-2006-1 Biochemical analysis of alginate biosynthesis protein AlgX from Pseudomonas aeruginosa: purification of an AlgX-MucD (AlgY) protein complex. ictbu Ictiobus bubalus (Smallmouth buffalo fish) Catostomus bubalus affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom ms participant Identification by mass spectrometry ms participant Gutsche J., Remminghorst U., Rehm BH. The cytoplasmic membrane with the non-ionic detergent Triton X-100. Figure 1. B.Rehm@massey.ac.nz Biochimie (0300-9084) 2006 bak1_arath BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 BAK1 SERK3 At4g33430 F17M5.190 Somatic embryogenesis receptor-like kinase 3 ELG Somatic embryogenesis receptor kinase 3 Protein ELONGATED protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERRLMIPCFFWLILVLDLVLRVSGNAEGDALSALKNSLADPNKVLQSWDATLVTPCTWFHVTCNSDNSVTRVDLGNANLSGQLVMQLGQLPNLQYLELYSNNITGTIPEQLGNLTELVSLDLYLNNLSGPIPSTLGRLKKLRFLRLNNNSLSGEIPRSLTAVLTLQVLDLSNNPLTGDIPVNGSFSLFTPISFANTKLTPLPASPPPPISPTPPSPAGSNRITGAIAGGVAAGAALLFAVPAIALAWWRRKKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPESQPPLDWPKRQRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGDGLAERWEEWQKEEMFRQDFNYPTHHPAVSGWIIGDSTSQIENEYPSGPR fls2_arath LRR receptor-like serine/threonine-protein kinase FLS2 FLS2 Protein FLAGELLIN-SENSING 2 Protein FLAGELLIN-SENSITIVE 2 MPL12.13 MPL12.8 At5g46330 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKLLSKTFLILTLTFFFFGIALAKQSFEPEIEALKSFKNGISNDPLGVLSDWTIIGSLRHCNWTGITCDSTGHVVSVSLLEKQLEGVLSPAIANLTYLQVLDLTSNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPSGIWELKNIFYLDLRNNLLSGDVPEEICKTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDLDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLRNLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGPIPSSISNCTGLKLLDLSHNQMTGEIPRGFGRMNLTFISIGRNHFTGEIPDDIFNCSNLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNNLLTGTIPKELGKLEMVQEIDLSNNLFSGSIPRSLQACKNVFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNNLKGHVPESGVFKNINASDLMGNTDLCGSKKPLKPCTIKQKSSHFSKRTRVILIILGSAAALLLVLLLVLILTCCKKKEKKIENSSESSLPDLDSALKLKRFEPKELEQATDSFNSANIIGSSSLSTVYKGQLEDGTVIAVKVLNLKEFSAESDKWFYTEAKTLSQLKHRNLVKILGFAWESGKTKALVLPFMENGNLEDTIHGSAAPIGSLLEKIDLCVHIASGIDYLHSGYGFPIVHCDLKPANILLDSDRVAHVSDFGTARILGFREDGSTTASTSAFEGTIGYLAPEFAYMRKVTTKADVFSFGIIMMELMTKQRPTSLNDEDSQDMTLRQLVEKSIGNGRKGMVRVLDMELGDSIVSLKQEEAIEDFLKLCLFCTSSRPEDRPDMNEILTHLMKLRGKANSFREDRNEDREV flica_pseai A-type flagellin fliC flaA protein protein pseai Pseudomonas aeruginosa MALTVNTNIASLNTQRNLNNSSASLNTSLQRLSTGSRINSAKDDAAGLQIANRLTSQVNGLNVATKNANDGISLAQTAEGALQQSTNILQRMRDLSLQSANGSNSDSERTALNGEVKQLQKELDRISNTTTFGGRKLLDGSFGVASFQVGSAANEIISVGIDEMSAESLNGTYFKADGGGAVTAATASGTVDIAIGITGGSAVNVKVDMKGNETAEQAAAKIAAAVNDANVGIGAFSDGDTISYVSKAGKDGSGAITSAVSGVVIADTGSTGVGTAAGVTPSATAFAKTNDTVAKIDISTAKGAQSAVLVIDEAIKQIDAQRADLGAVQNRFDNTINNLKNIGENVSAARGRIEDTDFAAETANLTKNQVLQQAGTAILAQANQLPQSVLSLLR j7dcm5_pseai exsA PACIG1_3608 protein protein pseudomonas aeruginosa cig1 Pseudomonas aeruginosa CIG1 MQGAKSLGRKQITSCHWNIPTFEYRVNKEEGVYVLLEGELTVQDIDSTFCLAPGELLFVRRGSYVVSTKGKDSRILWIPLSAQFLQGFVQRFGALLSEVERCDEPVPGIIAFAATPLLAGCVKGLKELLVHEHPPMLACLKIEELLMLFAFSPQGPLLMSVLRQLSNRHVERLQLFMEKHYLNEWKLSDFSREFGMGLTTFKELFGSVYGVSPRAWISERRILYAHQLLLNSDMSIVDIAMEAGFSSQSYFTQSYRRRFGCTPSRSRQGKDECRAKNN The sequence has been withdrawn from uniprot. p95429_pseai exsD E4V10_00450 PAMH19_5053 ECC04_020105 IPC1316_11625 IPC1339_18030 IPC614_16225 IPC1295_05320 IPC1323_11550 protein protein pseai Pseudomonas aeruginosa MEQEDDKQYSREAVFAGRRVSVVGSDARSRGRVPGYASSSLYRESGIISARQLALLQRMLPRLRLEQLFRCEWLQQRLARGLALGREEVRQILLCAAQDDDGWCAELGDRVNLAVPQSMIDWVLLPVYGWWESLLDQAIPGWRLSLVELETQSRQLRVKSEFWSRVAELEPEQAREELARVAKCQARTQEQVAELAGKLETASALAKSAWPNWQRGMATLLASGGLAGFEPIPEVLECLWQPLCRLDDDVGAADAVQAWLHERNLCQAQDHFYWQS exsceba promoter promoter of exsCEBA operon dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid pseai Pseudomonas aeruginosa GCGATGTGGCTTTTTTCTTAAAAGAAAAGTCTCTCAGTGACAAAAGCGATGCATAGCCCG q51451_pseai exoS protein protein pseai Pseudomonas aeruginosa MHIQSLQQSPSFAVELHQAASGRLGQIEARQVATPSEAQQLAQRQDAPKGEGLLARLGAALMRPFVAIMDWLGKLLGSHARTGPQPSQDAQPAVMSSAVVFKQMVLQQALPMTLKGLDKASELATLTPEGLAREHSRLASGDGALRSLSTALAGIRAGSQVEESRIQAGRLLERSIGGIALQQWGTTGGAASQLVLDASPELRREITDQLHQVMSEVALLRQAVESEVSRVSADKALADGLVKRFGADAEKYLGRQPGGIHSDAEVMALGLYTGIHYADLNRALRQGQELDAGQKLIDQGMSAAFEKSGQAEQVVKTFRGTRGGDAFNAVEEGKVGHDDGYLSTSLNPGVARSFGQGTISTVFGRSGIDVSGISNYKNEKEILYNKETDMRVLLSASDEQGVTRRVLEEAALGEQSGHSQGLLDALDLASKPERSGEVQEQDVRLRMRGLDLA rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL algx_pseae Alginate biosynthesis protein AlgX algX Probable alginate O-acetyltransferase AlgX PA3546 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MKTRTSRLFRLSALAAGLCLAQAALAADPGAAPSYQALPAGNLCPAAAYDSRYNTKYLGFFTHLVQAQDDWLFRTTYDLRTDFGTSAEGWRELRALRDELKRKGIELVVVYQPTRGLVNREKLSPAEKAGFDYELAKKNYLATIARFRQAGIWTPDFSPLFDEKEEHAYYFKGDHHWTPHGARRSAKIVAETLKQVPGFEEIPKKQFESKRVGLLSKLGTFHKAAAQLCGNSYATQYVDRFETEPVGASDSGDLFGDGGNPQIALVGTSNSGPAYNFAGFLEEFSGADILNNAVSGGGFDSSLLAYMTSEEFHKNPPKILIWEFATHYDMAQKSFYRQAMPLVDNGCSGRKTVLSRKVKLRQGRNEVLLNSAALPIRSGSYVADVTYSDPSVHELKNTIWYMNGRREQLKIEQSKAVDTGGRYVFQLRNDSDWADQQFLSLEIEAPEDMPQGLEVQASICQAAPAKASQSVAGR q51415_pseai algY protein protein pseai Pseudomonas aeruginosa MTSPFKVVAVSGGTYRPSRTLVLTQALIAELGQSLPIDSRVIELTDIAAPLGATLARNQAPAELQAVLDEIESADLLLVASPVYRGSYPGLLKHLFDLIDLNALIDTPVLLAATGNTSATRGPRPPVAPAVQLLPGDHPAHRGLRQRGRLRQLPDRQRAAEGAHPPRRRARRAAVRRTLRTVEDRLRCADERVLVPPDPRRWPLPRHQPGRAAGLAVLPEAGGTGGRQPWLSRRTDPHPTLLRRLLGGGLGLAPLTERLRFLVAIRPGIVSPTVSARMTATLDPVRWAPADQRGHRRRSRREPRRRHPFSATPSATRSPTSSSGLAARPAGRGGGLPRQAHPRGERQGALSAAATAVSAAVLRRFLGGRPRTGRRTGGRLPDLGRAVGGGGGENRRRAPASGSPWAYGEVRHPPACDRPRNRRRSLARRGQADRTHLRRNHRRRAAVLRPFRSGRPATHGRAARRPPRSPGDPAEPLGRGRPGARRRRHRAGRRSAAGGGAHRRIRRARHRQLHLLRLSAPGRGLPLRRTGLPAAVRTLRQPGRSWDDQPDRVVRRNDRQRRAAGSRRRLSSRAPEEKPPVNAKTRPEAQTPLQIVRRLAADFAENAAERDVAGGTPKAERDALRRSGLLSLIIPREYGGLGASWSETLQTVRELARVDSSIAHVYGFQHLMLATVRLFSRPEQ bak1-fls2-8 3326484 N/A flg22 peptide 3326655 ancillary ancillary neutral component neutral component purified purified flg22 peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3326508 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3326582 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 4c, 1d APEX knock-down greatly increasis interaction. exos-rac1-1 Crystal structure of the complex between the gap domain of the pseudomonas aeruginosa exos toxin and human rac 512297 N/A 512298 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 512299 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false dimeric, multimeric working 82.500%, free 77.600% 2A exsceba_promote-exsa 1330941 n/a 1330944 unspecified role unspecified role prey prey histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1330945 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1330946 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 5B exsceba_promo-exsa-2 1330941 n/a 1330946 unspecified role unspecified role bait bait n/a 1330944 unspecified role unspecified role prey prey histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5A exsceba_promo-exsa-1 1330941 n/a 1330946 unspecified role unspecified role bait bait n/a 1330944 unspecified role unspecified role prey prey histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) n/a 1330945 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5C exsa-exsceba_promote 1330942 n/a 1330944 unspecified role unspecified role neutral component neutral component histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1330946 unspecified role unspecified role neutral component neutral component n/a 1330945 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 3C exsa-exsceba_promo-1 1330942 n/a 1330945 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1330944 unspecified role unspecified role neutral component neutral component histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 3C exsa-exsa 1330943 n/a 1330944 unspecified role unspecified role neutral component neutral component histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1330946 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false Figure 6 algx-algy Affinity chromatograhy assay reveals AlgX interacting proteins. 336447 N/A 336448 unspecified role unspecified role prey prey N/A 336449 unspecified role unspecified role bait bait c terminal Strep-tag II tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint henriksson-2002-1 A nonphosphorylated 14-3-3 binding motif on exoenzyme S that is functional in vivo. in vitro In vitro experimental interac experimental interaction detection experimental interac predetermined predetermined participant predetermined Henriksson ML., Francis MS., Peden A., Aili M., Stefansson K., Palmer R., Aitken A., Hallberg B. Virus - Publications including interactions involving viral proteins Eur. J. Biochem. (0014-2956) 2002 henrikss-2002-1 A nonphosphorylated 14-3-3 binding motif on exoenzyme S that is functional in vivo. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Henriksson ML., Francis MS., Peden A., Aili M., Stefansson K., Palmer R., Aitken A., Hallberg B. Virus - Publications including interactions involving viral proteins Eur. J. Biochem. (0014-2956) 2002 anonymous-2013za-2 Interfacial residues of SpcS chaperone affects binding of effector toxin ExoT in Pseudomonas aeruginosa: novel insights from structural and computational studies in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined saumen_datta@iicb.res.in 2013 imex curation Dey S., Datta S. FEBS J. (1742-464X) 2014 Only protein-protein interactions anonymous-2013n-1 Interfacial residues of SpcS chaperone affects binding of effector toxin ExoT in Pseudomonas aeruginosa: novel insights from structural and computational studies in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined saumen_datta@iicb.res.in 2013 imex curation Dey S., Datta S. FEBS J. (1742-464X) 2014 Only protein-protein interactions ottmann-2007-1 Phosphorylation-independent interaction between 14-3-3 and exoenzyme S: from structure to pathogenesis. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ottmann C., Yasmin L., Weyand M., Veesenmeyer JL., Diaz MH., Palmer RH., Francis MS., Hauser AR., Wittinghofer A., Hallberg B. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation q933j5_pseai exoS protein protein pseai Pseudomonas aeruginosa MHIQSLQQSPSFAVELHQAASGRLGQIEARQVATPSEAQQLAQRQDAPKGEGLLARLGAALVRPFVAIMDWLGKLLGSHARTGPQPSQDAQPAVMSSAVVFKQMVLQQALPMTLKGLDKASELATLTPEGLAREHSRLASGDGALRSLSTALAGIRAGSQVEESRIQAGRLLERSIGGIALQQWGTTGGASSQLVLDASPELRREITDQLHQVMSEVALLRQAVESEVSRVSADKALADGLVKRFGADAEKYLGRQPGGIHSDAEVMALGLYTGIHYADLNRALRQGQELDAGQKLIDQGMSAAFEKSGQAEQVVKTFRGTRGGDAFNAVEEGKVGHDDGYLSTSLNPGVARSFGQGTISTVFGRSGIDVSGISNYKNEKEILYNKETDMRVLLSASDEQGVTRRVLEEAALGEQSGHSQGLLDALDLASKPERSGEVQEQDVRLRMRGLDLA mint q51451_pseai exoS protein protein pseai Pseudomonas aeruginosa MHIQSLQQSPSFAVELHQAASGRLGQIEARQVATPSEAQQLAQRQDAPKGEGLLARLGAALMRPFVAIMDWLGKLLGSHARTGPQPSQDAQPAVMSSAVVFKQMVLQQALPMTLKGLDKASELATLTPEGLAREHSRLASGDGALRSLSTALAGIRAGSQVEESRIQAGRLLERSIGGIALQQWGTTGGAASQLVLDASPELRREITDQLHQVMSEVALLRQAVESEVSRVSADKALADGLVKRFGADAEKYLGRQPGGIHSDAEVMALGLYTGIHYADLNRALRQGQELDAGQKLIDQGMSAAFEKSGQAEQVVKTFRGTRGGDAFNAVEEGKVGHDDGYLSTSLNPGVARSFGQGTISTVFGRSGIDVSGISNYKNEKEILYNKETDMRVLLSASDEQGVTRRVLEEAALGEQSGHSQGLLDALDLASKPERSGEVQEQDVRLRMRGLDLA 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 1433s_human 14-3-3 protein sigma Stratifin Epithelial cell marker protein 1 HME1 SFN protein protein human Homo sapiens Human MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN 1433g_human 14-3-3 protein gamma YWHAG Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN 1433t_human 14-3-3 protein theta YWHAQ 14-3-3 protein tau 14-3-3 protein T-cell Protein HS1 protein protein human Homo sapiens Human MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN o87126_pseai IPC1323_19940 RW109_RW109_04790 GNQ48_02290 IPC1316_20860 IPC1339_09710 IPC1598_09725 IPC29_00260 IPC614_18010 orf1 motC pomA PAMH19_4713 CAZ10_08270 DT376_21175 CGU42_25945 ECC04_021720 NCTC13621_01359 IPC90_23615 motA2 IPC1295_03995 PA52Ts2_2498 protein protein pseai Pseudomonas aeruginosa MDVLSLVGIILAFVAIVGGNFLEGGHAGALLNGPAALIVIGGTLAAALLQTPVNVLKRGLGMLGWVFFPPREDLSGGIDRIVSWSMTARKEGLLGLESIADAEPDPYARKGLQLLVDGAEPEVIRSILEVDLFTQESRDLQAAKVFESMGGYAPTIGIIGAVMGLIHVMGNLANPAQLGSGIAVAFVATIYGVGFANLLLLPIGNKLKTLVLRQSRYREMLLEGLLSIAEGENPRSIELKLQGFMD a3lgl6_pseai PA2G_03957 protein protein pseudomonas aeruginosa 2192 Pseudomonas aeruginosa 2192 MHIQSSQQNPSFVAELSQAVAGRLGQVEARQVATPREAQQLAQRQEAPKGEGLLSRLGAALARPFVAIIEWLGKLLGSRAHASTQAPLSRQDAPPAASLSAAEIKQMMLQKALPLTLGGLGKASELATLTAERLAKDHTRLASGDGALRSLATALVGIRDGSRIEASRTQAARLLEQSVGGIALQQWGTAGGAASQHVLSASPEQLREIAVQLHAVMDKVALLRHAVESEVKGEPVDKALADGLVEHFGLEAEQYLGEHPDGPYSDAEVMALGLYTNGEYQHLNRSLRQGRELDAGQALIDRGMSAAFEKSGPAEQVVKTFRGTQGRDAFEAVKEGQVGHDAGYLSTSRDPSVARSFAGQGTITTLFGRSGIDVSEISIEGDEQEILYDKGTDMRVLLSAKDGQGVTRRVLEEATLGERSGHGEGLLDALDLATGTDRSGKPQEQDLRLRMRGLDLA The sequence has been withdrawn from uniprot. exos-ywhaz-1 13058 q51451_pseae Q51451 13060 unspecified role unspecified role unspecified role unspecified role purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1433z_human 1433Z 13061 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association false false false mint exos-ywhae 13058 1433e_human 1433E 13062 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 q51451_pseae Q51451 13060 unspecified role unspecified role unspecified role unspecified role purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 association association false false false mint exos-ywhab 13058 q51451_pseae Q51451 13060 unspecified role unspecified role unspecified role unspecified role purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1433b_human 1433B 13063 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association false false false mint exos-sfn 13058 1433s_human 1433S 13064 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 q51451_pseae Q51451 13060 unspecified role unspecified role unspecified role unspecified role purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 association association false false false mint exos-ywhah 13058 q51451_pseae Q51451 13060 unspecified role unspecified role unspecified role unspecified role purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1433f_human 1433F 13065 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association false false false mint exos-ywhag 13058 q51451_pseae Q51451 13060 unspecified role unspecified role unspecified role unspecified role purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1433g_human 1433G 13066 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association false false false mint exos-ywhaq 13058 q51451_pseae Q51451 13060 unspecified role unspecified role unspecified role unspecified role purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1433t_human 1433T 13067 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association false false false mint exos-ywhae-1 13059 q51451_pseae Q51451 13060 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1433e_human 1433E 13062 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false mint exos-ywhag-1 13059 q51451_pseae Q51451 13060 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1433g_human 1433G 13066 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false mint exos-ywhab-1 13059 q51451_pseae Q51451 13060 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1433b_human 1433B 13063 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false mint exos-sfn-1 13059 q51451_pseae Q51451 13060 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 1433s_human 1433S 13064 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false mint exos-ywhaz-2 13059 1433z_human 1433Z 13061 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 q51451_pseae Q51451 13060 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 direct interaction direct interaction false false false mint exos-ywhaq-1 13059 1433t_human 1433T 13067 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 q51451_pseae Q51451 13060 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 direct interaction direct interaction false false false mint exos-ywhah-1 13059 1433f_human 1433F 13065 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 q51451_pseae Q51451 13060 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 direct interaction direct interaction false false false mint a3lgl6-orf1-2 1472981 n/a SpcS 1472983 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified n/a ExoT 1472984 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 1472981 t2 sf6 Single mutants (SpcSN65A, SpcSF67A and SpcSW88A) mildly affected the effectorchaperone interaction as reflected from 20 to 30-fold decrease in binding affinity. However, drastic effects were noted for the double mutants- SpcSN65A/W88A and SpcSF67A/W88A where the binding affinity of the effector got 100 fold reduced (44.8 μM and 34.8 μM, respectively), a3lgl6-orf1-3 1472981 n/a SpcS 1472983 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified undefined mutation trp65ala,ala88ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a ExoT 1472984 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 1472981 t2 sf6 Single mutants (SpcSN65A, SpcSF67A and SpcSW88A) mildly affected the effectorchaperone interaction as reflected from 20 to 30-fold decrease in binding affinity. However, drastic effects were noted for the double mutants- SpcSN65A/W88A and SpcSF67A/W88A where the binding affinity of the effector got 100 fold reduced (44.8 μM and 34.8 μM, respectively), a3lgl6-orf1-4 1472981 n/a SpcS 1472983 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified undefined mutation phe67ala,ala88ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a ExoT 1472984 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 1472981 t2 sf6 Single mutants (SpcSN65A, SpcSF67A and SpcSW88A) mildly affected the effectorchaperone interaction as reflected from 20 to 30-fold decrease in binding affinity. However, drastic effects were noted for the double mutants- SpcSN65A/W88A and SpcSF67A/W88A where the binding affinity of the effector got 100 fold reduced (44.8 μM and 34.8 μM, respectively), a3lgl6-orf1 1472982 n/a SpcS 1472983 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 n/a ExoT 1472984 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false t1 f1 f2 f3 f4 sf2 sf1 exos-ywhaz 594317 q933j5_pseae 594318 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false 1433z_human 14-3-3zeta 13061 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false F3 F4 F2 F1 mint DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ tosi-2014-1 ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds weight by comassie molecular weight estimation by coomasie staining weight by comassie Tosi T., Estrozi LF., Job V., Guilvout I., Pugsley AP., Schoehn G., Dessen A. DIP original experiment: DIP-261988X Structure (London, England : 1993) 2014 IMEx Structural similarity of secretins from type II and type III secretion systems. Tosi T., Estrozi LF., Job V., Guilvout I., Pugsley AP., Schoehn G., Dessen A. Only protein-protein interactions imex curation tosi-2014-4 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Tosi T., Estrozi LF., Job V., Guilvout I., Pugsley AP., Schoehn G., Dessen A. DIP original experiment: DIP-261989X Structure (London, England : 1993) 2014 IMEx Structural similarity of secretins from type II and type III secretion systems. Tosi T., Estrozi LF., Job V., Guilvout I., Pugsley AP., Schoehn G., Dessen A. Only protein-protein interactions imex curation tosi-2014-5 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Tosi T., Estrozi LF., Job V., Guilvout I., Pugsley AP., Schoehn G., Dessen A. DIP original experiment: DIP-261990X Structure (London, England : 1993) 2014 IMEx Structural similarity of secretins from type II and type III secretion systems. Tosi T., Estrozi LF., Job V., Guilvout I., Pugsley AP., Schoehn G., Dessen A. Only protein-protein interactions imex curation ge-2015-1 pseai Pseudomonas aeruginosa tem transmission electron microscopy tem predetermined predetermined participant predetermined Ge P., Scholl D., Leiman PG., Yu X., Miller JF., Zhou ZH. DIP original experiment: DIP-265995X Nature structural & molecular biology 2015 IMEx Atomic structures of a bactericidal contractile nanotube in its pre- and postcontraction states. Ge P., Scholl D., Leiman PG., Yu X., Miller JF., Zhou ZH. Only protein-protein interactions imex curation ge-2015-2 pseai Pseudomonas aeruginosa tem transmission electron microscopy tem predetermined predetermined participant predetermined Ge P., Scholl D., Leiman PG., Yu X., Miller JF., Zhou ZH. DIP original experiment: DIP-265992X Nature structural & molecular biology 2015 IMEx Atomic structures of a bactericidal contractile nanotube in its pre- and postcontraction states. Ge P., Scholl D., Leiman PG., Yu X., Miller JF., Zhou ZH. Only protein-protein interactions imex curation ge-2015-3 pseai Pseudomonas aeruginosa 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Ge P., Scholl D., Leiman PG., Yu X., Miller JF., Zhou ZH. DIP original experiment: DIP-265993X Nature structural & molecular biology 2015 IMEx Atomic structures of a bactericidal contractile nanotube in its pre- and postcontraction states. Ge P., Scholl D., Leiman PG., Yu X., Miller JF., Zhou ZH. Only protein-protein interactions imex curation ge-2015-4 pseai Pseudomonas aeruginosa 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Ge P., Scholl D., Leiman PG., Yu X., Miller JF., Zhou ZH. DIP original experiment: DIP-265994X Nature structural & molecular biology 2015 IMEx Atomic structures of a bactericidal contractile nanotube in its pre- and postcontraction states. Ge P., Scholl D., Leiman PG., Yu X., Miller JF., Zhou ZH. Only protein-protein interactions imex curation wilke-2008-1 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Wilke MS., Heller M., Creagh AL., Haynes CA., McIntosh LP., Poole K., Strynadka NC. DIP original experiment: DIP-113412X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The crystal structure of MexR from Pseudomonas aeruginosa in complex with its antirepressor ArmR. Wilke MS., Heller M., Creagh AL., Haynes CA., McIntosh LP., Poole K., Strynadka NC. Only protein-protein interactions imex curation wilke-2008-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wilke MS., Heller M., Creagh AL., Haynes CA., McIntosh LP., Poole K., Strynadka NC. DIP original experiment: DIP-113410X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The crystal structure of MexR from Pseudomonas aeruginosa in complex with its antirepressor ArmR. Wilke MS., Heller M., Creagh AL., Haynes CA., McIntosh LP., Poole K., Strynadka NC. Only protein-protein interactions imex curation wilke-2008-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wilke MS., Heller M., Creagh AL., Haynes CA., McIntosh LP., Poole K., Strynadka NC. DIP original experiment: DIP-113411X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The crystal structure of MexR from Pseudomonas aeruginosa in complex with its antirepressor ArmR. Wilke MS., Heller M., Creagh AL., Haynes CA., McIntosh LP., Poole K., Strynadka NC. Only protein-protein interactions imex curation wilke-2008-4 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Wilke MS., Heller M., Creagh AL., Haynes CA., McIntosh LP., Poole K., Strynadka NC. DIP original experiment: DIP-113413X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The crystal structure of MexR from Pseudomonas aeruginosa in complex with its antirepressor ArmR. Wilke MS., Heller M., Creagh AL., Haynes CA., McIntosh LP., Poole K., Strynadka NC. Only protein-protein interactions imex curation wilke-2008-5 in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Wilke MS., Heller M., Creagh AL., Haynes CA., McIntosh LP., Poole K., Strynadka NC. DIP original experiment: DIP-113414X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx The crystal structure of MexR from Pseudomonas aeruginosa in complex with its antirepressor ArmR. Wilke MS., Heller M., Creagh AL., Haynes CA., McIntosh LP., Poole K., Strynadka NC. Only protein-protein interactions imex curation sun-2013-5 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Sun Y., Li L., Macho AP., Han Z., Hu Z., Zipfel C., Zhou JM., Chai J. DIP original experiment: DIP-266808X Science (New York, N.Y.) 2013 IMEx Structural basis for flg22-induced activation of the Arabidopsis FLS2-BAK1 immune complex. Sun Y., Li L., Macho AP., Han Z., Hu Z., Zipfel C., Zhou JM., Chai J. Only protein-protein interactions imex curation sun-2013-6 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Sun Y., Li L., Macho AP., Han Z., Hu Z., Zipfel C., Zhou JM., Chai J. DIP original experiment: DIP-266799X Science (New York, N.Y.) 2013 IMEx Structural basis for flg22-induced activation of the Arabidopsis FLS2-BAK1 immune complex. Sun Y., Li L., Macho AP., Han Z., Hu Z., Zipfel C., Zhou JM., Chai J. Only protein-protein interactions imex curation sun-2013-7 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Sun Y., Li L., Macho AP., Han Z., Hu Z., Zipfel C., Zhou JM., Chai J. DIP original experiment: DIP-266803X Science (New York, N.Y.) 2013 IMEx Structural basis for flg22-induced activation of the Arabidopsis FLS2-BAK1 immune complex. Sun Y., Li L., Macho AP., Han Z., Hu Z., Zipfel C., Zhou JM., Chai J. Only protein-protein interactions imex curation sun-2013-9 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Sun Y., Li L., Macho AP., Han Z., Hu Z., Zipfel C., Zhou JM., Chai J. DIP original experiment: DIP-266802X Science (New York, N.Y.) 2013 IMEx Structural basis for flg22-induced activation of the Arabidopsis FLS2-BAK1 immune complex. Sun Y., Li L., Macho AP., Han Z., Hu Z., Zipfel C., Zhou JM., Chai J. Only protein-protein interactions imex curation sun-2013-10 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Sun Y., Li L., Macho AP., Han Z., Hu Z., Zipfel C., Zhou JM., Chai J. DIP original experiment: DIP-266809X Science (New York, N.Y.) 2013 IMEx Structural basis for flg22-induced activation of the Arabidopsis FLS2-BAK1 immune complex. Sun Y., Li L., Macho AP., Han Z., Hu Z., Zipfel C., Zhou JM., Chai J. Only protein-protein interactions imex curation sun-2013-11 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Sun Y., Li L., Macho AP., Han Z., Hu Z., Zipfel C., Zhou JM., Chai J. DIP original experiment: DIP-266801X Science (New York, N.Y.) 2013 IMEx Structural basis for flg22-induced activation of the Arabidopsis FLS2-BAK1 immune complex. Sun Y., Li L., Macho AP., Han Z., Hu Z., Zipfel C., Zhou JM., Chai J. Only protein-protein interactions imex curation sun-2013-14 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Sun Y., Li L., Macho AP., Han Z., Hu Z., Zipfel C., Zhou JM., Chai J. DIP original experiment: DIP-266800X Science (New York, N.Y.) 2013 IMEx Structural basis for flg22-induced activation of the Arabidopsis FLS2-BAK1 immune complex. Sun Y., Li L., Macho AP., Han Z., Hu Z., Zipfel C., Zhou JM., Chai J. Only protein-protein interactions imex curation sun-2013-16 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Sun Y., Li L., Macho AP., Han Z., Hu Z., Zipfel C., Zhou JM., Chai J. DIP original experiment: DIP-266805X Science (New York, N.Y.) 2013 IMEx Structural basis for flg22-induced activation of the Arabidopsis FLS2-BAK1 immune complex. Sun Y., Li L., Macho AP., Han Z., Hu Z., Zipfel C., Zhou JM., Chai J. Only protein-protein interactions imex curation yang-2006-42 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. DIP original experiment: DIP-264144X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for protein-protein interactions in the 14-3-3 protein family. Yang X., Lee WH., Sobott F., Papagrigoriou E., Robinson CV., Grossmann JG., Sundström M., Doyle DA., Elkins JM. Only protein-protein interactions imex curation lintz-2011-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lintz MJ., Oinuma K., Wysoczynski CL., Greenberg EP., Churchill ME. DIP original experiment: DIP-249701X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of QscR, a Pseudomonas aeruginosa quorum sensing signal receptor. Lintz MJ., Oinuma K., Wysoczynski CL., Greenberg EP., Churchill ME. Only protein-protein interactions imex curation q9s574_pseai FIR2 protein protein pseai Pseudomonas aeruginosa MSFFHGVTVTNVDIGARTIALPASSVIGLCDVFTPGAQASAKPNVPVLLTSKKDAAAAFGIGSSIYLACEAIYNRAQAVIVAVGVETAETPEAQASAVIGGISAAGERTGLQALLDGKSRFNAQPRLLVAPGHSAQQAVATAMDGLAEKLRAIAILDGPNSTDEAAVAYAKNFGSKRLFMVDPGVQVWDSATNAARNAPASAYAAGLFAWTDAEYGFWSSPSNKEIKGVTGTSRPVEFLDGDETCRANLLNNANIATIIRDDGYRLWGNRTLSSDSKWAFVTRVRTMDLVMDAILAGHKWAVDRGITKTYVKDVTEGLRAFMRDLKNQGAVINFEVYADPDLNSASQLAQGKVYWNIRFTDVPPAENPNFRVEVTDQWLTEVLDVA q9s573_pseai FIIR2 protein protein pseai Pseudomonas aeruginosa MMIPQTLTNTNLFIDGVSFAGDVPSLTLPKLAVKTEQYRAGGMDAPVSIDMGLEAMEAKFSTNGARREALNFFGLADQSAFNGVFRGSFKGQKGASVPVVATLRGLLKEVDPGDWKAGEKAEFKYAVAVSYYKLEVDGREVYEIDPVNGVRAINGVDQLAGMRNDLGL p95431_pseai Type 3 secretion system secretin IPC1295_05330 IPC737_28880 PA52Ts2_2769 pscC sctC CGU42_24605 ECC04_020095 IPC1323_11540 GNQ48_00970 IPC1316_11615 IPC614_16215 protein protein pseai Pseudomonas aeruginosa MRRLLIGGLLALLPGAVLRAQPLDWPSLPYDYVAQGESLRDVLANFGANYDASVIVSDKVNDQVSGRFDLESPQAFLQLMASLYNLGWYYDGTVLYVFKTTEMQSRLVRLEQVGEAELKRALTAAGIWEPRFGWRADPSGRLVHVSGPGRYLELVEQTAQVLEQQYTLRSEKTGDLSVEIFPLRYAVAEDRKIEYRDDEIEAPGIASILSRVLSDANVVAVGDEPGKLRPGPQSSHAVVQAEPSLNAVVVRDHKDRLPMYRRLIEALDRPSARIEVGLSIIDINAENLAQLGVDWSAGIRLGNNKSIQIRTTGQDSEEGGGAGNGAVGSLVDSRGLDFLLAKVTLLQSQGQAQIGSRPTLLTQENTQAVLDQSETYYVRVTGERVAELKAITYGTMLKMTPRVVTLGDTPEISLSLHIEDGSQKPNSAGLDKIPTINRTVIDTIARVGHGQSLLIGGIYRDELSQSQRKVPWLGDIPYLGALFRTTADTVRRSVRLFLIEPRLIDDGVGHYLALNNRRDLRGGLLEIDELSNQSLSLRKLLGSARCQALAPARAEQERLRQAGQGSFLTPCRMGAQEGWRVTDGACPKDGAWCVGAERGN q9rms5_pseai IPC737_29575 DT376_23495 ECC04_019105 E4V10_12590 CAZ10_26210 phzR qscR PAMH19_5306 ALP65_03645 IPC116_18515 IPC1316_10625 IPC1339_17030 IPC1598_18230 IPC29_09655 IPC614_32130 IPC90_26725 IPC1323_26100 NCTC13621_00173 protein protein pseai Pseudomonas aeruginosa MHDEREGYLEILSRITTEEEFFSLVLEICGNYGFEFFSFGARAPFPLTAPKYHFLSNYPGEWKSRYISEDYTSIDPIVRHGLLEYTPLIWNGEDFQENRFFWEEALHHGIRHGWSIPVRGKYGLISMLSLVRSSESIAATEILEKESFLLWITSMLQATFGDLLAPRIVPESNVRLTARETEMLKWTAVGKTYGEIGLILSIDQRTVKFHIVNAMRKLNSSNKAEATMKAYAIGLLN 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN q51451_pseai exoS protein protein pseai Pseudomonas aeruginosa MHIQSLQQSPSFAVELHQAASGRLGQIEARQVATPSEAQQLAQRQDAPKGEGLLARLGAALMRPFVAIMDWLGKLLGSHARTGPQPSQDAQPAVMSSAVVFKQMVLQQALPMTLKGLDKASELATLTPEGLAREHSRLASGDGALRSLSTALAGIRAGSQVEESRIQAGRLLERSIGGIALQQWGTTGGAASQLVLDASPELRREITDQLHQVMSEVALLRQAVESEVSRVSADKALADGLVKRFGADAEKYLGRQPGGIHSDAEVMALGLYTGIHYADLNRALRQGQELDAGQKLIDQGMSAAFEKSGQAEQVVKTFRGTRGGDAFNAVEEGKVGHDDGYLSTSLNPGVARSFGQGTISTVFGRSGIDVSGISNYKNEKEILYNKETDMRVLLSASDEQGVTRRVLEEAALGEQSGHSQGLLDALDLASKPERSGEVQEQDVRLRMRGLDLA flica_pseai A-type flagellin fliC flaA protein protein pseai Pseudomonas aeruginosa MALTVNTNIASLNTQRNLNNSSASLNTSLQRLSTGSRINSAKDDAAGLQIANRLTSQVNGLNVATKNANDGISLAQTAEGALQQSTNILQRMRDLSLQSANGSNSDSERTALNGEVKQLQKELDRISNTTTFGGRKLLDGSFGVASFQVGSAANEIISVGIDEMSAESLNGTYFKADGGGAVTAATASGTVDIAIGITGGSAVNVKVDMKGNETAEQAAAKIAAAVNDANVGIGAFSDGDTISYVSKAGKDGSGAITSAVSGVVIADTGSTGVGTAAGVTPSATAFAKTNDTVAKIDISTAKGAQSAVLVIDEAIKQIDAQRADLGAVQNRFDNTINNLKNIGENVSAARGRIEDTDFAAETANLTKNQVLQQAGTAILAQANQLPQSVLSLLR bak1_arath BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 BAK1 SERK3 At4g33430 F17M5.190 Somatic embryogenesis receptor-like kinase 3 ELG Somatic embryogenesis receptor kinase 3 Protein ELONGATED protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERRLMIPCFFWLILVLDLVLRVSGNAEGDALSALKNSLADPNKVLQSWDATLVTPCTWFHVTCNSDNSVTRVDLGNANLSGQLVMQLGQLPNLQYLELYSNNITGTIPEQLGNLTELVSLDLYLNNLSGPIPSTLGRLKKLRFLRLNNNSLSGEIPRSLTAVLTLQVLDLSNNPLTGDIPVNGSFSLFTPISFANTKLTPLPASPPPPISPTPPSPAGSNRITGAIAGGVAAGAALLFAVPAIALAWWRRKKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPESQPPLDWPKRQRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGDGLAERWEEWQKEEMFRQDFNYPTHHPAVSGWIIGDSTSQIENEYPSGPR fls2_arath LRR receptor-like serine/threonine-protein kinase FLS2 FLS2 Protein FLAGELLIN-SENSING 2 Protein FLAGELLIN-SENSITIVE 2 MPL12.13 MPL12.8 At5g46330 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKLLSKTFLILTLTFFFFGIALAKQSFEPEIEALKSFKNGISNDPLGVLSDWTIIGSLRHCNWTGITCDSTGHVVSVSLLEKQLEGVLSPAIANLTYLQVLDLTSNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPSGIWELKNIFYLDLRNNLLSGDVPEEICKTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDLDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLRNLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGPIPSSISNCTGLKLLDLSHNQMTGEIPRGFGRMNLTFISIGRNHFTGEIPDDIFNCSNLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNNLLTGTIPKELGKLEMVQEIDLSNNLFSGSIPRSLQACKNVFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNNLKGHVPESGVFKNINASDLMGNTDLCGSKKPLKPCTIKQKSSHFSKRTRVILIILGSAAALLLVLLLVLILTCCKKKEKKIENSSESSLPDLDSALKLKRFEPKELEQATDSFNSANIIGSSSLSTVYKGQLEDGTVIAVKVLNLKEFSAESDKWFYTEAKTLSQLKHRNLVKILGFAWESGKTKALVLPFMENGNLEDTIHGSAAPIGSLLEKIDLCVHIASGIDYLHSGYGFPIVHCDLKPANILLDSDRVAHVSDFGTARILGFREDGSTTASTSAFEGTIGYLAPEFAYMRKVTTKADVFSFGIIMMELMTKQRPTSLNDEDSQDMTLRQLVEKSIGNGRKGMVRVLDMELGDSIVSLKQEEAIEDFLKLCLFCTSSRPEDRPDMNEILTHLMKLRGKANSFREDRNEDREV mexr_pseae Multidrug resistance operon repressor mexR PA0424 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQPLEDI 59F5146394BE89DD q8gq91_pseai armR basR_3 DY940_15825 NCTC12924_04578 protein protein pseai Pseudomonas aeruginosa MRILLVEDDKLIGRGIVAGLHKHGIAVHHVGTAEEAEATHAEDTFHALVLDLGLPDRDGMELLASMRAVEPQLPVLILTARDAIEHRLKGLHEGADDYMIKPFDLRELAARLHALVRRTQGRAAQVISAGPLRLEPESGLAWFQGEPVSLSRREVDLLAHLANADGRWVPPDMLNERLYGLGEEIGSNALNVHIHNIRRKLGAEAIETVRGLGYRLGWRLAS pscc-1 3294706 N/A 3294712 unspecified role unspecified role unspecified role unspecified role Region 233-506 Region 233-506 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pscc-2 3294709 N/A 3294712 unspecified role unspecified role unspecified role unspecified role Region 233-506 Region 233-506 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pscc-3 3294710 N/A 3294712 unspecified role unspecified role unspecified role unspecified role Region 233-506 Region 233-506 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false fir2-1 3277687 N/A 3277691 unspecified role unspecified role unspecified role unspecified role pseai Pseudomonas aeruginosa direct interaction direct interaction false false false fiir2-fir2-1 3277688 N/A 3277692 unspecified role unspecified role unspecified role unspecified role pseai Pseudomonas aeruginosa N/A 3277691 unspecified role unspecified role unspecified role unspecified role pseai Pseudomonas aeruginosa direct interaction direct interaction false false false fiir2-fir2-2 3277689 N/A 3277692 unspecified role unspecified role unspecified role unspecified role pseai Pseudomonas aeruginosa N/A 3277691 unspecified role unspecified role unspecified role unspecified role pseai Pseudomonas aeruginosa direct interaction direct interaction false false false fir2-2 3277690 N/A 3277691 unspecified role unspecified role unspecified role unspecified role pseai Pseudomonas aeruginosa direct interaction direct interaction false false false armr-mexr-2 3177818 N/A 3177823 unspecified role unspecified role unspecified role unspecified role Region 29-53 Region 29-53 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3177824 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false armr-mexr-3 3177819 N/A 3177823 unspecified role unspecified role unspecified role unspecified role Region 29-53 Region 29-53 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3177824 unspecified role unspecified role unspecified role unspecified role Region 1-142 Region 1-142 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false armr-mexr-4 3177820 N/A 3177823 unspecified role unspecified role unspecified role unspecified role Region 29-53 Region 29-53 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3177824 unspecified role unspecified role unspecified role unspecified role Region 1-142 Region 1-142 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false armr-mexr-5 3177821 N/A 3177823 unspecified role unspecified role unspecified role unspecified role Region 41-53 Region 41-53 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3177824 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false armr-mexr-6 3177822 N/A 3177823 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3177824 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false flic-bak1-1 3259132 N/A 3259144 unspecified role unspecified role prey prey His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 1-220 Region 1-220 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3259145 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P21184:p.Gly47Tyr G47Y mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P21184:p.Gly47Ala G47A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Region 30-51 Region 30-51 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false bak1-flic-1 3259133 N/A 3259145 unspecified role unspecified role unspecified role unspecified role Region 30-51 Region 30-51 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3259144 unspecified role unspecified role unspecified role unspecified role Region 1-220 Region 1-220 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3259146 unspecified role unspecified role unspecified role unspecified role Region 25-800 Region 25-800 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false flic-bak1-2 3259134 N/A 3259144 unspecified role unspecified role prey prey Region 1-220 Region 1-220 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q94F62:p.Leu53Ala L53A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q94F62:p.Val54Tyr V54Y mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q94F62:p.Tyr96Ala Y96A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q94F62:p.[Phe60Ala;Phe144Ala] F60A/F144A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3259145 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 30-51 Region 30-51 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false flic-fls2-1 3259136 N/A 3259145 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 30-51 Region 30-51 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3259146 unspecified role unspecified role prey prey Region 25-800 Region 25-800 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false flic-fls2-2 3259137 N/A 3259145 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P21184:p.Asp43Ala D43A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P21184:p.Asp44Ala D44A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P21184:p.Ala46Tyr A46Y mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Region 30-51 Region 30-51 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3259146 unspecified role unspecified role prey prey Region 25-800 Region 25-800 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false flic-bak1-3 3259138 N/A 3259144 unspecified role unspecified role prey prey Region 1-220 Region 1-220 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3259145 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 30-51 Region 30-51 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3259146 unspecified role unspecified role prey prey Region 25-800 Region 25-800 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper association association false false false flic-fls2-3 3259141 N/A 3259145 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 30-51 Region 30-51 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3259146 unspecified role unspecified role prey prey Region 25-800 Region 25-800 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9FL28:p.[Arg294Ala;His316Ala] R294A/H316A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9FL28:p.Thr342Tyr T342Y mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9FL28:p.Ser437Tyr S437Y mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q9FL28:p.Asp414Ala D414A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false bak1-flic-2 3259143 N/A 3259145 unspecified role unspecified role unspecified role unspecified role Region 30-51 Region 30-51 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3259144 unspecified role unspecified role unspecified role unspecified role Region 1-220 Region 1-220 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3259146 unspecified role unspecified role unspecified role unspecified role Region 25-800 Region 25-800 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association false false false exos-ywhab-2 3150046 N/A 3150053 unspecified role unspecified role unspecified role unspecified role Region 421-431 Region 421-431 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3150049 unspecified role unspecified role unspecified role unspecified role Region 1-239 Region 1-239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false phzr-1 3230374 N/A 3230375 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false