DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wiedenheft-2011-1 ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249579X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions imex curation wiedenheft-2011-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249577X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions imex curation wiedenheft-2011-3 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249584X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions imex curation wiedenheft-2011-4 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249585X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions imex curation wiedenheft-2011-5 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249581X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions imex curation wiedenheft-2011-6 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249583X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions imex curation wiedenheft-2011-7 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249580X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions imex curation wiedenheft-2011-8 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249578X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions imex curation wiedenheft-2011-9 ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249582X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions imex curation wiedenheft-2011-10 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249586X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions imex curation morris-2013-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Morris ER., Hall G., Li C., Heeb S., Kulkarni RV., Lovelock L., Silistre H., Messina M., Cámara M., Emsley J., Williams P., Searle MS. DIP original experiment: DIP-255761X Structure (London, England : 1993) 2013 IMEx Structural rearrangement in an RsmA/CsrA ortholog of Pseudomonas aeruginosa creates a dimeric RNA-binding protein, RsmN. Morris ER., Hall G., Li C., Heeb S., Kulkarni RV., Lovelock L., Silistre H., Messina M., Cámara M., Emsley J., Williams P., Searle MS. Only protein-protein interactions imex curation morris-2013-2 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Morris ER., Hall G., Li C., Heeb S., Kulkarni RV., Lovelock L., Silistre H., Messina M., Cámara M., Emsley J., Williams P., Searle MS. DIP original experiment: DIP-255762X Structure (London, England : 1993) 2013 IMEx Structural rearrangement in an RsmA/CsrA ortholog of Pseudomonas aeruginosa creates a dimeric RNA-binding protein, RsmN. Morris ER., Hall G., Li C., Heeb S., Kulkarni RV., Lovelock L., Silistre H., Messina M., Cámara M., Emsley J., Williams P., Searle MS. Only protein-protein interactions imex curation morris-2013-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Morris ER., Hall G., Li C., Heeb S., Kulkarni RV., Lovelock L., Silistre H., Messina M., Cámara M., Emsley J., Williams P., Searle MS. DIP original experiment: DIP-255763X Structure (London, England : 1993) 2013 IMEx Structural rearrangement in an RsmA/CsrA ortholog of Pseudomonas aeruginosa creates a dimeric RNA-binding protein, RsmN. Morris ER., Hall G., Li C., Heeb S., Kulkarni RV., Lovelock L., Silistre H., Messina M., Cámara M., Emsley J., Williams P., Searle MS. Only protein-protein interactions imex curation wiedenheft-2009-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wiedenheft B., Zhou K., Jinek M., Coyle SM., Ma W., Doudna JA. DIP original experiment: DIP-132060X Structure (London, England : 1993) 2009 IMEx Structural basis for DNase activity of a conserved protein implicated in CRISPR-mediated genome defense. Wiedenheft B., Zhou K., Jinek M., Coyle SM., Ma W., Doudna JA. Only protein-protein interactions imex curation wiedenheft-2009-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wiedenheft B., Zhou K., Jinek M., Coyle SM., Ma W., Doudna JA. DIP original experiment: DIP-132061X Structure (London, England : 1993) 2009 IMEx Structural basis for DNase activity of a conserved protein implicated in CRISPR-mediated genome defense. Wiedenheft B., Zhou K., Jinek M., Coyle SM., Ma W., Doudna JA. Only protein-protein interactions imex curation bondy_denomy-2015-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight silver stain molecular weight estimation by silver staining weight silver stain Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267054X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions imex curation bondy_denomy-2015-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267058X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions imex curation bondy_denomy-2015-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267068X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions imex curation bondy_denomy-2015-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267064X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions imex curation bondy_denomy-2015-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight silver stain molecular weight estimation by silver staining weight silver stain Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267059X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions imex curation bondy_denomy-2015-6 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight silver stain molecular weight estimation by silver staining weight silver stain Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267055X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions imex curation bondy_denomy-2015-7 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267062X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions imex curation bondy_denomy-2015-8 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267065X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions imex curation bondy_denomy-2015-9 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight silver stain molecular weight estimation by silver staining weight silver stain Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267060X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions imex curation bondy_denomy-2015-10 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267063X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions imex curation bondy_denomy-2015-11 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267066X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions imex curation bondy_denomy-2015-12 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267056X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions imex curation bondy_denomy-2015-13 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267067X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions imex curation bondy_denomy-2015-14 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267057X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions imex curation bondy_denomy-2015-15 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267061X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions imex curation a0a0h2ziz8_pseab PA14_68470 protein protein pseab Pseudomonas aeruginosa (strain UCBPP-PA14) MGFLILSRREGEGITLSLKADYPAEELIRQLREGGIRILVTDIIGNQARVGIEAPRGVLIVRDELKTAPKG acr30_bpd31 Anti-CRISPR protein 30 orf30 Gene product 30 protein protein bpd31 Pseudomonas phage D3112 Bacteriophage D3112 MIAQQHKDTVAACEAAEAIAIAKDQVWDGEGYTKYTFDDNSVLIQSGTTQYAMDADDADSIKGYADWLDDEARSAEASEIERLLESVEEE l7p7r7_9caud JBD5_035 protein protein pseudomonas phage jbd5 Pseudomonas phage JBD5 MSNTISDRIVARSVIEAARFIQSWEDADPDSLTEDQVLAAAGFAARLHEGLQATVLQRLVDESNHEEYREFKAWEEALLNADGRVASSPFADWGWWYRIANVMLATASQNVGVTWGSRVHGRLMAIFQDKFKQRYEEQA h6v8p1_9caud HMPREFV_HMPID9848gp0037 protein protein pseudomonas phage jbd26 Pseudomonas phage JBD26 MMTISKTDIDCYLQTYVVIDPVSNGWQWGIDENGVGGALHHGRVEMVEGENGYFGLRGATHPTEKEAMAAALGYLWKCRQDLVAIARNDAIEAEKYRAKA l7p7m1_9caud JBD30_035 protein protein pseudomonas phage jbd30 Pseudomonas phage JBD30 MKFIKYLSTAHLNYMNIAVYENGSKIKARVENVVNGKSVGARDFDSTEQLESWFYGLPGSGLGRIENAMNEISRRENP cas3_pseab CRISPR-associated nuclease/helicase Cas3 subtype I-F/YPEST cas3 PA14_33340 protein protein pseab Pseudomonas aeruginosa (strain UCBPP-PA14) MNILLVSQCEKRALSETRRILDQFAERRGERTWQTPITQAGLDTLRRLLKKSARRNTAVACHWIRGRDHSELLWIVGDASRFNAQGAVPTNRTCRDILRKEDENDWHSAEDIRLLTVMAALFHDIGKASQAFQAKLRNRGKPMADAYRHEWVSLRLFEAFVGPGSSDEDWLRRLADKRETGDAWLSQLARDDRQSAPPGPFQKSRLPPLAQAVGWLIVSHHRLPNGDHRGSASLARLPAPIQSQWCGARDADAKEKAACWQFPHGLPFASAHWRARTALCAQSMLERPGLLARGPALLHDSYVMHVSRLILMLADHHYSSLPADSRLGDPNFPLHANTDRDSGKLKQRLDEHLLGVALHSRKLAGTLPRLERQLPRLARHKGFTRRVEQPRFRWQDKAYDCAMACREQAMEHGFFGLNLASTGCGKTLANGRILYALADPQRGARFSIALGLRSLTLQTGQAYRERLGLGDDDLAILVGGSAARELFEKQQERLERSGSESAQELLAENSHVHFAGTLEDGPLREWLGRNSAGNRLLQAPILACTIDHLMPASESLRGGHQIAPLLRLMTSDLVLDEVDDFDIDDLPALSRLVHWAGLFGSRVLLSSATLPPALVQGLFEAYRSGREIFQRHRGAPGRATEIRCAWFDEFSSQSSAHGAVTSFSEAHATFVAQRLAKLEQLPPRRQAQLCTVHAAGEARPALCRELAGQMNTWMADLHRCHHTEHQGRRISFGLLRLANIEPLIELAQAILAQGAPEGLHVHLCVYHSRHPLLVRSAIERQLDELLKRSDDDAAALFARPTLAKALQASTERDHLFVVLASPVAEVGRDHDYDWAIVEPSSMRSIIQLAGRIRRHRSGFSGEANLYLLSRNIRSLEGQNPAFQRPGFETPDFPLDSHDLHDLLDPALLARIDASPRIVEPFPLFPRSRLVDLEHRRLRALMLADDPPSSLLGVPLWWQTPASLSGALQTSQPFRAGAKERCYALLPDEDDEERLHFSRYEEGTWSNQDNLLRNLDLTYGPRIQTWGTVNYREELVAMAGREDLDLRQCAMRYGEVRLRENTQGWSYHPYLGFKKYN cas1_pseab CRISPR-associated endonuclease Cas1 cas1 PA14_33350 protein protein pseab Pseudomonas aeruginosa (strain UCBPP-PA14) MDDISPSELKTILHSKRANLYYLQHCRVLVNGGRVEYVTDEGRHSHYWNIPIANTTSLLLGTGTSITQAAMRELARAGVLVGFCGGGGTPLFSANEVDVEVSWLTPQSEYRPTEYLQRWVGFWFDEEKRLVAARHFQRARLERIRHSWLEDRVLRDAGFAVDATALAVAVEDSARALEQAPNHEHLLTEEARLSKRLFKLAAQATRYGEFVRAKRGSGGDPANRFLDHGNYLAYGLAATATWVLGIPHGLAVLHGKTRRGGLVFDVADLIKDSLILPQAFLSAMRGDEEQDFRQACLDNLSRAQALDFMIDTLKDVAQRSTVSA cas6_pseab CRISPR-associated endonuclease Cas6/Csy4 cas6f csy4 PA14_33300 protein protein pseab Pseudomonas aeruginosa (strain UCBPP-PA14) MDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQVSRVQAKSNPERLRRRLMRRHDLSEEEARKRIPDTVARALDLPFVTLRSQSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF csy2_pseab CRISPR-associated protein Csy2 csy2 PA14_33320 protein protein pseab Pseudomonas aeruginosa (strain UCBPP-PA14) MSVTDPEALLLLPRLSIQNANAISSPLTWGFPSPGAFTGFVHALQRRVGISLDIELDGVGIVCHRFEAQISQPAGKRTKVFNLTRNPLNRDGSTAAIVEEGRAHLEVSLLLGVHGDGLDDHPAQEIARQVQEQAGAMRLAGGSILPWCNERFPAPNAELLMLGGSDEQRRKNQRRLTRRLLPGFALVSREALLQQHLETLRTTLPEATTLDALLDLCRINFEPPATSSEEEASPPDAAWQVRDKPGWLVPIPAGYNALSPLYLPGEVRNARDRETPLRFVENLFGLGEWLSPHRVAALSDLLWYHHAEPDKGLYRWSTPRFVEHAIA csy3_pseab CRISPR-associated protein Csy3 csy3 csy1-3 PA14_33310 protein protein pseab Pseudomonas aeruginosa (strain UCBPP-PA14) MSKPILSTASVLAFERKLDPSDALMSAGAWAQRDASQEWPAVTVREKSVRGTISNRLKTKDRDPAKLDASIQSPNLQTVDVANLPSDADTLKVRFTLRVLGGAGTPSACNDAAYRDKLLQTVATYVNDQGFAELARRYAHNLANARFLWRNRVGAEAVEVRINHIRQGEVARAWRFDALAIGLRDFKADAELDALAELIASGLSGSGHVLLEVVAFARIGDGQEVFPSQELILDKGDKKGQKSKTLYSVRDAAAIHSQKIGNALRTIDTWYPDEDGLGPIAVEPYGSVTSQGKAYRQPKQKLDFYTLLDNWVLRDEAPAVEQQHYVIANLIRGGVFGEAEEK csy1_pseab CRISPR-associated protein Csy1 csy1 PA14_33330 protein protein pseab Pseudomonas aeruginosa (strain UCBPP-PA14) MTSPLPTPTWQELRQFIESFIQERLQGKLDKLQPDEDDKRQTLLATHRREAWLADAARRVGQLQLVTHTLKPIHPDARGSNLHSLPQAPGQPGLAGSHELGDRLVSDVVGNAAALDVFKFLSLQYQGKNLLNWLTEDSAEALQALSDNAEQAREWRQAFIGITTVKGAPASHSLAKQLYFPLPGSGYHLLAPLFPTSLVHHVHALLREARFGDAAKAAREARSRQESWPHGFSEYPNLAIQKFGGTKPQNISQLNNERRGENWLLPSLPPNWQRQNVNAPMRHSSVFEHDFGRTPEVSRLTRTLQRFLAKTVHNNLAIRQRRAQLVAQICDEALQYAARLRELEPGWSATPGCQLHDAEQLWLDPLRAQTDETFLQRRLRGDWPAEVGNRFANWLNRAVSSDSQILGSPEAAQWSQELSKELTMFKEILEDERD cas6f-csy1-1 3225817 N/A 3225827 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false cas6f-csy1-2 3225818 N/A 3225827 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false csy3-cas6f-1 3225819 N/A 3225827 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3225828 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3225829 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3225830 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false cas6f-csy1-3 3225820 N/A 3225827 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3225828 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3225829 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3225830 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false cas6f-csy1-4 3225821 N/A 3225827 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false csy2-cas6f-1 3225822 N/A 3225827 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3225828 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3225829 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3225830 unspecified role unspecified role prey prey ecolx Escherichia coli association association false false false cas6f-csy1-5 3225823 N/A 3225827 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false csy1-csy2-1 3225824 N/A 3225829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false csy1-cas6f-1 3225825 N/A 3225827 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3225828 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3225829 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3225830 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false cas6f-csy3-1 3225826 N/A 3225827 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false rsmn-1 3294659 N/A 3294662 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false rsmn-2 3294660 N/A 3294662 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false rsmn-3 3294661 N/A 3294662 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cas1-1 3192727 N/A 3192729 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cas1-2 3192728 N/A 3192729 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cas6f-csy1-6 3284376 N/A 3225827 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false csy1-csy2-2 3284377 N/A 3284395 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false cas6f-csy1-7 3284378 N/A 3225827 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false csy1-csy2-3 3284379 N/A 3225828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false csy1-csy2-4 3284380 N/A 3225829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cas6f-csy1-8 3284381 N/A 3284396 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225827 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false cas6f-csy1-9 3284382 N/A 3225829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3284395 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3284396 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225827 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false csy1-csy2-5 3284383 N/A 3284395 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false cas6f-csy1-10 3284384 N/A 3284395 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225827 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false csy1-csy2-6 3284385 N/A 3284396 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false cas6f-csy1-11 3284386 N/A 3284396 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225827 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false cas3-l7p7r7_9caud-1 3284387 N/A 3284397 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3284398 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cas6f-csy1-12 3284388 N/A 3284395 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225827 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false csy3-l7p7m1_9caud-1 3284389 N/A 3284396 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false cas6f-csy1-13 3284390 N/A 3284399 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225827 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225828 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3225830 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint gabrielsen-2012-1 FolX from Pseudomonas aeruginosa is octameric in both crystal and solution. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Gabrielsen M., Beckham KS., Cogdell RJ., Byron O., Roe AJ. FEBS Lett. (0014-5793) 2012 gabriels-2012-1 FolX from Pseudomonas aeruginosa is octameric in both crystal and solution. in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Gabrielsen M., Beckham KS., Cogdell RJ., Byron O., Roe AJ. FEBS Lett. (0014-5793) 2012 gabriels-2012-2 FolX from Pseudomonas aeruginosa is octameric in both crystal and solution. in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Gabrielsen M., Beckham KS., Cogdell RJ., Byron O., Roe AJ. FEBS Lett. (0014-5793) 2012 bernhards-2013-1 Self-trimerization of ExsD limits inhibition of the Pseudomonas aeruginosa transcriptional activator ExsA in vitro. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column experimental particp experimental participant identification experimental particp Bernhards RC., Marsden AE., Esher SK., Yahr TL., Schubot FD. FEBS J. (1742-464X) 2013 a0a0h2zeg5_pseab folX PA14_19620 protein protein pseab Pseudomonas aeruginosa (strain UCBPP-PA14) MPRLEPGMARIRVKDLRLRTFIGIKEEEILNKQDVLINLTILYPAADAVEVNDIEHALNYRTITKAIIRHVEENRFALLERMTQEILDLVMENPAVRYAEVEVDKPHALRFAESVSITLAGHR mint a0a0h2z989_pseab exsD PA14_42380 protein protein pseab Pseudomonas aeruginosa (strain UCBPP-PA14) MEQEDDKQYSREAVFAGRRVSVVGSDARSRGRVPGYASSSLYRESGIISARQLALLQRMLPRLRLEQLFRCEWLQQRLARGLALGREEVRQILLCAAQDDDGWCAELGDRVNLAVPQSMIDWVLLPVYGWWESLLDQAIPGWRLSLVELETQSRQLRIKSEFWSRVAELEPEQAREELARVAKCQARTQEQVAELAGKLETASALAKSAWPNWQRGMATLLASGGLAGFEPIPEVLECLWQPLCRLDDDVGAADAVQAWLHERNLCQAQDHFYWQS mint folx-1 1280446 folx FolX 1280449 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 8.0 direct interaction direct interaction false false false mint t1 f3 st2 folx-1 1280447 folx FolX 1280449 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 8.0 direct interaction direct interaction false false false f4 mint folx-1 1280448 folx FolX 1280449 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 8.0 direct interaction direct interaction false false false 1280448 f5a mint exsd 1350027 exsd ExsD 1350029 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified A0A0H2Z989:p.Met59Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 3.0 direct interaction direct interaction false false false f2b mint