mpidb The Microbial Protein Interaction Database nanatani-2009-1 Structural and functional importance of transmembrane domain 3 (TM3) in the aspartate:alanine antiporter AspT: topology and function of the residues of TM3 and oligomerization of AspT. ecolx Escherichia coli crosslink cross-linking study crosslink weight silver stain molecular weight estimation by silver staining weight silver stain Nanatani K., Maloney P.C., Abe K. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation aspt_tetha Aspartate/alanine antiporter aspT protein protein pediococcus halophil Tetragenococcus halophilus MNAIGNFLVGTPVFTIFICLALGYLLGKLKIGSFTLGATVGVLIVALLIGQLGVFPRDTLLGDIFFDFFMFAIGYRVGPSFISSMKKFGAKIVYATLIFLVSAFIVAYACFKMFHIGPGIAAGIIAGGLTQSAVIGSSLETISKLPISDHLKTLYSNQIPIVYTLTYVFGTIGVLIFLRDIMPKLMHIDLKKQAVKTAKELDMIPVPVIVASTHFYTINDGSSLIGQTLGTVNTKFAKGLVAAGLNDSADMASVINAGDVLAISGGIDEIGRAVQEFNLLEVTGKTKAYVSKQVVLKKNFSADVLKNAQDKGVLVATLAGDVMDPAQFSTLKPAESVTLVGQKDAVSEVQSQLGRLRAAENIINYSWFALGIALSAALGIVGTKVSGVPIALGGGTASLIVGLVQSIYRDKHAHMDTIPDSLLEFFQSIGLNLFIATVGLSAAKTFISAIQSMGISVLLIGAVISILPHIITFVICYYLMKMEPISIIGAQTGADTLSAALNDVSERVGSDASPFFAAAVAPAYAIGNIFLTLMGPIFIVLLS aspt-aspt 1335291 not-defined-1645355959 1335292 unspecified role unspecified role unspecified role unspecified role q8l3k8-- Q8L3K8-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1110619033 1335292 unspecified role unspecified role unspecified role unspecified role q8l3k8-- Q8L3K8-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Figure 4C aspt-aspt-1 1335291 not-defined-241249418 1335292 unspecified role unspecified role unspecified role unspecified role Q8L3K8:p.Tyr75Cys Q8L3K8-75-75 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q8L3K8:p.Met85Cys Q8L3K8-85-85 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q8L3K8:p.Phe66Ser Q8L3K8-66-66 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q8L3K8:p.Ser80Cys Q8L3K8-80-80 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q8L3K8:p.Val77Cys Q8L3K8-77-77 mutation mutation certain certain sequence position certain certain certain sequence position certain false Q8L3K8:p.Gly62Cys Q8L3K8-62-62 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q8L3K8:p.Gly74Cys Q8L3K8-74-74 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false Q8L3K8:p.Leu61Cys Q8L3K8-61-61 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q8L3K8:p.Phe88Cys Q8L3K8-88-88 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q8L3K8:p.Leu60Cys Q8L3K8-60-60 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q8L3K8:p.Phe65Ser Q8L3K8-65-65 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q8L3K8:p.Phe81Cys Q8L3K8-81-81 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q8L3K8:p.Ile64Cys Q8L3K8-64-64 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q8L3K8:p.Phe71Ser Q8L3K8-71-71 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q8L3K8:p.Gly78Cys Q8L3K8-78-78 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q8L3K8:p.Ile73Cys Q8L3K8-73-73 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q8L3K8:p.Thr59Cys Q8L3K8-59-59 mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 direct interaction direct interaction false false false Figure 2 and 3