mpidb The Microbial Protein Interaction Database chatterjee-2009-1 RsmC of Erwinia carotovora subsp. carotovora negatively controls motility, extracellular protein production, and virulence by binding FlhD and modulating transcriptional activity of the master regulator, FlhDC. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chatterjee A., Cui Y., Chatterjee A.K. chatterjeeas@missouri.edu J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation q9r2p5_peccc RC98_14720 hexY rsmC protein protein peccc Pectobacterium carotovorum subsp. carotovorum MSLIFGRNEILGMLSQPVQNDRRAVAVIDEKCKVVCANSAFNAHFGLRAEMNTPVSIDDVLPINVKFAYHDFMTNSNMLSTRVVSDLLSDGFTKKQLSTLSFSKLNVENRVLSLLILNQDAVEPSTNLAS flhd_serma Flagellar transcriptional regulator FlhD flhD protein protein serma Serratia marcescens MGNMGTSELLKHIYDINLSYLLLAQRLINDEKASAMFRLGIDETMADALAQLTLPQMVKLAETNQLVCHFRFNESQTIERLTKESRVDDLQQIHTGILLSSHLLQELSSKDASPTKKRA c7fdi0_peccc Flagellar transcriptional regulator FlhD flhD protein protein peccc Pectobacterium carotovorum subsp. carotovorum MGNMGTSELLKHIYDINLSYLLLAQRLINDEKASAMFRLGINDEMADILMQLTLPQMVKLAETNQLICHFRFNDHNTIKILTQESRVDDLQQIHTGILLSSHLLQQLTSKEENLPKKRA c7fdi1_peccc Flagellar transcriptional regulator FlhC flhC RC98_04800 EGD00_08595 protein protein peccc Pectobacterium carotovorum subsp. carotovorum MAEKSIVQEAKDIQLAMELISLGARLQMLESETQLSRGRLIKLYKELRGSPPPKGMLPFSTDWFMTWEQNIHSSMFYNAYSFLIKNGQCSGVEAVIKSYRLYLEQCAPQSDSPLLALTRAWTLVRFVDSGMLQLSSCNCCKGMFITHAHQPKNSFVCSLCQPPSRAVKRRKLSQNLADIIPQLLDEQVKHAV flhd_ecoli Flagellar transcriptional regulator FlhD flhD flbB b1892 JW1881 protein protein ecoli Escherichia coli (strain K12) MHTSELLKHIYDINLSYLLLAQRLIVQDKASAMFRLGINEEMATTLAALTLPQMVKLAETNQLVCHFRFDSHQTITQLTQDSRVDDLQQIHTGIMLSTRLLNDVNQPEEALRKKRA hexy-flhd 1335956 not-defined-1726557840 1335957 unspecified role unspecified role bait bait not-defined-232685601 1335958 unspecified role unspecified role prey prey physical association physical association false false false Table 7 hexy-flhd-3 1335956 n/a 1335959 unspecified role unspecified role prey prey not-defined-1726557840 1335957 unspecified role unspecified role bait bait physical association physical association false false false Table 6 hexy-flhd-4 1335956 n/a 1335959 unspecified role unspecified role prey prey n/a 1335960 unspecified role unspecified role ancillary ancillary not-defined-1726557840 1335957 unspecified role unspecified role bait bait physical association physical association false false false Table 6 hexy-flhd-1 1335956 not-defined-1943158285 1335961 unspecified role unspecified role prey prey not-defined-145503631 1335957 unspecified role unspecified role bait bait physical association physical association false false false Table 7