MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint gosslers-2009-1 An orphan dermaseptin from frog skin reversibly assembles to amyloid-like aggregates in a pH-dependent fashion. in vitro In vitro biophysical biophysical predetermined predetermined participant predetermined Gössler-Schöfberger R., Hesser G., Muik M., Wechselberger C., Jilek A. FEBS J. (1742-464X) 2009 Only protein-protein interactions imex curation g_ssler_sch-2009-1 An orphan dermaseptin from frog skin reversibly assembles to amyloid-like aggregates in a pH-dependent fashion. in vitro In vitro fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Gössler-Schöfberger R., Hesser G., Muik M., Wechselberger C., Jilek A. FEBS J. (1742-464X) 2009 Only protein-protein interactions imex curation gosslers-2009-2 An orphan dermaseptin from frog skin reversibly assembles to amyloid-like aggregates in a pH-dependent fashion. in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Gössler-Schöfberger R., Hesser G., Muik M., Wechselberger C., Jilek A. FEBS J. (1742-464X) 2009 Only protein-protein interactions imex curation gosslers-2009-3 An orphan dermaseptin from frog skin reversibly assembles to amyloid-like aggregates in a pH-dependent fashion. in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Gössler-Schöfberger R., Hesser G., Muik M., Wechselberger C., Jilek A. FEBS J. (1742-464X) 2009 Only protein-protein interactions imex curation gosslers-2009-4 An orphan dermaseptin from frog skin reversibly assembles to amyloid-like aggregates in a pH-dependent fashion. in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Gössler-Schöfberger R., Hesser G., Muik M., Wechselberger C., Jilek A. FEBS J. (1742-464X) 2009 Only protein-protein interactions imex curation dru_agadc Dermaseptin PD-3-7 protein protein pacda Pachymedusa dacnicolor MSFMKKSLLLVLFLGVVSLSNCEEEKGENENEDHEEHHEEKRLLGDLLGQTSKLVNDLTDTVGSIV mint dms5 837639 dms5_pacda Dermaseptin 837644 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false mint f2c f4d dms5-1 837640 dms5_pacda Dermaseptin 837644 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f2b mint dms5-1 837641 dms5_pacda Dermaseptin 837644 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f2d mint dms5-1 837642 dms5_pacda Dermaseptin 837644 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false mint f3 f4b dms5-1 837643 dms5_pacda Dermaseptin 837644 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f4c mint