DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ coulibaly-2009-1 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Coulibaly F., Chiu E., Gutmann S., Rajendran C., Haebel PW., Ikeda K., Mori H., Ward VK., Schulze-Briese C., Metcalf P. DIP original experiment: DIP-134879X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The atomic structure of baculovirus polyhedra reveals the independent emergence of infectious crystals in DNA and RNA viruses. Coulibaly F., Chiu E., Gutmann S., Rajendran C., Haebel PW., Ikeda K., Mori H., Ward VK., Schulze-Briese C., Metcalf P. Only protein-protein interactions imex curation kadlec-2008-1 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kadlec J., Loureiro S., Abrescia NG., Stuart DI., Jones IM. DIP original experiment: DIP-113563X Nature structural & molecular biology 2008 IMEx The postfusion structure of baculovirus gp64 supports a unified view of viral fusion machines. Kadlec J., Loureiro S., Abrescia NG., Stuart DI., Jones IM. Only protein-protein interactions imex curation kadlec-2008-2 spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kadlec J., Loureiro S., Abrescia NG., Stuart DI., Jones IM. DIP original experiment: DIP-113564X Nature structural & molecular biology 2008 IMEx The postfusion structure of baculovirus gp64 supports a unified view of viral fusion machines. Kadlec J., Loureiro S., Abrescia NG., Stuart DI., Jones IM. Only protein-protein interactions imex curation pyhd_npvac Polyhedrin PH P29 POLH Major occlusion protein protein protein npvac Autographa californica nuclear polyhedrosis virus (AcMNPV) AcMNPV MPDYSYRPTIGRTYVYDNKYYKNLGAVIKNAKRKKHFAEHEIEEATLDPLDNYLVAEDPFLGPGKNQKLTLFKEIRNVKPDTMKLVVGWKGKEFYRETWTRFMEDSFPIVNDQEVMDVFLVVNMRPTRPNRCYKFLAQHALRCDPDYVPHDVIRIVEPSWVGSNNEYRISLAKKGGGCPIMNLHSEYTNSFEQFIDRVIWENFYKPIVYIGTDSAEEEEILLEVSLVFKVKEFAPDAPLFTGPAY mint fus_npvac Major envelope glycoprotein GP64 GP67 gp64 ORF128 protein protein npvac Autographa californica nuclear polyhedrosis virus (AcMNPV) AcMNPV MVSAIVLYVLLAAAAHSAFAAEHCNAQMKTGPYKIKNLDITPPKETLQKDVEITIVETDYNENVIIGYKGYYQAYAYNGGSLDPNTRVEETMKTLNVGKEDLLMWSIRQQCEVGEELIDRWGSDSDDCFRDNEGRGQWVKGKELVKRQNNNHFAHHTCNKSWRCGISTSKMYSRLECQDDTDECQVYILDAEGNPINVTVDTVLHRDGVSMILKQKSTFTTRQIKAACLLIKDDKNNPESVTREHCLIDNDIYDLSKNTWNCKFNRCIKRKVEHRVKKRPPTWRHNVRAKYTEGDTATKGDLMHIQEELMYENDLLKMNIELMHAHINKLNNMLHDLIVSVAKVDERLIGNLMNNSVSSTFLSDDTFLLMPCTNPPAHTSNCYNNSIYKEGRWVANTDSSQCIDFSNYKELAIDDDVEFWIPTIGNTTYHDSWKDASGWSFIAQQKSNLITTMENTKFGGVGTSLSDITSMAEGELAAKLTSFMFGHVVNFVIILIVILFLYCMIRNRNRQY ph-1 3200868 N/A 3200870 unspecified role unspecified role unspecified role unspecified role spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false gp64-1 3177285 N/A 3177287 unspecified role unspecified role unspecified role unspecified role Region 1-499 Region 1-499 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false gp64-2 3177286 N/A 3177287 unspecified role unspecified role unspecified role unspecified role Region 1-499 Region 1-499 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint xu-2001-1 Covalent inhibition revealed by the crystal structure of the caspase-8/p35 complex. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Xu G., Cirilli M., Huang Y., Rich RL., Myszka DG., Wu H. Apoptosis - Interactions involving proteins with a function related to apoptosis Nature (0028-0836) 2001 PDBe - Data obtained from the Protein Data Bank Europe ji-2010-1 How baculovirus polyhedra fit square pegs into round holes to robustly package viruses. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ji X., Sutton G., Evans G., Axford D., Owen R., Stuart DI. EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD p35_npvac Early 35 kDa protein P35 p35 Apoptosis-preventing protein protein protein npvac Autographa californica nuclear polyhedrosis virus (AcMNPV) AcMNPV MCVIFPVEIDVSQTIIRDCQVDKQTRELVYINKIMNTQLTKPVLMMFNISGPIRSVTRKNNNLRDRIKSKVDEQFDQLERDYSDQMDGFHDSIKYFKDEHYSVSCQNGSVLKSKFAKILKSHDYTDKKSIEAYEKYCLPKLVDERNDYYVAVCVLKPGFENGSNQVLSFEYNPIGNKVIVPFAHEINDTGLYEYDVVAYVDSVQFDGEQFEEFVQSLILPSSFKNSEKVLYYNEASKNKSMIYKALEFTTESSWGKSEKYNWKIFCNGFIYDKKSKVLYVKLHNVTSALNKNVILNTIK pyhd_npvac Polyhedrin PH P29 POLH Major occlusion protein protein protein npvac Autographa californica nuclear polyhedrosis virus (AcMNPV) AcMNPV MPDYSYRPTIGRTYVYDNKYYKNLGAVIKNAKRKKHFAEHEIEEATLDPLDNYLVAEDPFLGPGKNQKLTLFKEIRNVKPDTMKLVVGWKGKEFYRETWTRFMEDSFPIVNDQEVMDVFLVVNMRPTRPNRCYKFLAQHALRCDPDYVPHDVIRIVEPSWVGSNNEYRISLAKKGGGCPIMNLHSEYTNSFEQFIDRVIWENFYKPIVYIGTDSAEEEEILLEVSLVFKVKEFAPDAPLFTGPAY mint casp8-p35-1 Crystal structure of the caspase-8/p35 complex 99691 N/A 99692 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 99693 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false tetrameric, multimeric working 76.400%, free 70.400% 3A ph-2 896043 pyhd_npvac Polyhedrin 896044 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 3.0 direct interaction direct interaction false false false mint f1c f1d f1e t1 sf3 sf7 ph-2 896043 pyhd_npvac Polyhedrin 896044 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 12.0 covalent binding covalent binding false false false mint f1e f4a sf4 ph-2 896043 pyhd_npvac Polyhedrin 896044 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 covalent binding covalent binding false false false f5a mint