DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ martin-2020-3 nicbe-leaf Nicotiana benthamiana leaf leaf leaf 3d-em-single electron microscopy 3D single particle reconstruction 3D-EM-single experimental particp experimental participant identification experimental particp Martin R., Qi T., Zhang H., Liu F., King M., Toth C., Nogales E., Staskawicz BJ. :enogales@lbl.gov, stask@berkeley.edu Science (New York, N.Y.) 2020 Only protein-protein interactions imex curation imex curation martin-2020-4 nicbe-leaf Nicotiana benthamiana leaf leaf leaf pull down pull down experimental particp experimental participant identification experimental particp Martin R., Qi T., Zhang H., Liu F., King M., Toth C., Nogales E., Staskawicz BJ. :enogales@lbl.gov, stask@berkeley.edu Science (New York, N.Y.) 2020 Only protein-protein interactions imex curation imex curation roq1_nicbe Disease resistance protein Roq1 NAD(+) hydrolase RPV1 Recognition of XopQ 1 protein ROQ1 protein protein nicbe Nicotiana benthamiana MLTSSSHHGRSYDVFLSFRGEDTRKTFVGHLFNALIEKGIHTFMDDKELKRGKSISSELMKAIGESRFAVVVFSKNYASSTWCLEELVKILEIHEKFELIVVPVFYDVDPSTVRKQNGEYAVCFTKFEANLVDDRDKVLRWREALTKVANISGHDLRNTYNGDESKCIQQILKDIFDKFCFSISITNRDLVGIESQIKKLSSLLRMDLKGVRLVGIWGMGGVGKTTAARALFNRYYQNFESACFLEDVKEYLQHHTLLYLQKTLLSKLLKVEFVDCTDTEEMCVILKRRLCSKKVLVVLDDVNHNDQLDKLVGAEDWFGSGSRIVITTRDMKLLKNHDVHETYEIKVLEKDEAIELFNLHAFKRSSPEKEFKELLNLVVDYTGGLPLALKVLGSLLYKEDLDVWISTIDRLKDNPEGEIMATLKISFDGLRDYEKSIFLDIACFFRGYNQRDMTALFHASGFHPVLGVKTLVEKSLIFILEDKIQMHDLMQEMGRQIAVQESPMRRIYRPEDVKDACIGDMRKEAIEGLLLTEPEQFEEGELEYMYSAEALKKTRRLRILVKEYYNRGFDEPVAYLPNSLLWLEWRNYSSNSFPSNFEPSKLVYLTMKGSSIIELWNGAKRLAFLTTLDLSYCHKLIQTPDFRMITNLERLILSSCDALVEVHPSVGFLKNLILLNMDHCISLERLPAIIQSECLEVLDLNYCFNLKMFPEVERNMTHLKKLDLTSTGIRELPASIEHLSSLENLQMHSCNQLVSLPSSIWRFRNLKISECEKLGSLPEIHGNSNCTRELILKLVSIKELPTSIGNLTSLNFLEICNCKTISSLSSSIWGLTSLTTLKLLDCRKLKNLPGIPNAINHLSGHGLQLLLTLEQPTIYERLDLLRIIDMSWCSCISSLPHNIWMLKFLRILCISYCSRLEYLPENLGHLEHLEELLADGTGILRLPSSVARLNKLEVLSFRKKFAIGPKVQYSSSMLNLPDDVFGSLGSLGSVVKLNLSGNGFCNLPETMNQLFCLEYLDITFCQRLEALPELPPSIKELYVDEHLALRIMEDLVIKCKELNLIAVTKIEYQNFYRWLDSIWSDVSELLENSQKQQLDDMLQLIPFSYLSTAKREEVLKIVIHGTRIPEWFRWQDRSATTMSVNLPEYWYTENFLGFAICCSCCFYHSARSYDVEFEGSMHHYNYDSSYWKEYEEPSYDFYERDSIEITAKLTPRHKGMRTEELKKVCSFSMNVLRRATAVPNMCFAFFPFNSLCHISNLQANNPNDYGIFETCLSPGDIRHRGKQWGFNLVYKDETGGSVTHEMLINR q5qa88_xaneu xopQ protein protein Xanthomonas euvesicatoria Xanthomonas euvesicatoria MQPTAIRSTVGLPGADMTADLRDPAPVAVPAHSAADAAAPPPGALQTIVGRPPRPDGPRHRRAQSLPARLTPAQRGMLAELGVADTSVLTPTETAVLRELRLHRPPLPLDTLLFTDPNKDPDDVVTYTIAKQLQAEGFLRLTDVVVTLGDADMRSQRAQLAKGVFDRLALPEVRVARGQDYPMTSTQAREHSKFLAEGAALRAAPDAVHTDGVRAMRERLATSPHKLGMVVIAGMTDASALLAEAGDLVREKLASITIMGGIDPARDADGLVQPDTRAYNNATDIHAARALYRRAQQLGIPLRILSKEAAYRAAVPPAFYEGIARNGHPVGEYLRDVQKNALKGLWEGIQANLIPGLDTAWFFRTFVAAQPQDPAAADQQGAMSFDAIWPQVTKLNLYDPLTLLAALPGAARLLFQPTPMHREGASPVEHVGHAEVVRPEKARLLLSALAKAALAQQDEGQRGR roq1-xopq-1 3966061 N/A 3966063 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified StrepII tag StrepII tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe-leaf Nicotiana benthamiana leaf leaf leaf Stoichiometry: 1.0 N/A 3966064 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified Flag tag Flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe-leaf Nicotiana benthamiana leaf leaf leaf Stoichiometry: 1.0 direct interaction direct interaction false false false Fig 1, Table S1 roq1-1 3966061 N/A 3966064 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified Flag tag Flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe-leaf Nicotiana benthamiana leaf leaf leaf Stoichiometry: 4.0 direct interaction direct interaction false false false Fig 1, Table S1 xopq-roq1-1 3966062 N/A 3966064 weight silver stain molecular weight estimation by silver staining weight silver stain predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Flag tag Flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false nicbe-leaf Nicotiana benthamiana leaf leaf leaf N/A 3966063 weight silver stain molecular weight estimation by silver staining weight silver stain predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed StrepII tag StrepII tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe-leaf Nicotiana benthamiana leaf leaf leaf physical association physical association false false false Fig S13 IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ caplan-2008-3 Chloroplastic protein NRIP1 mediates innate immune receptor recognition of a viral effector. nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Caplan JL., Mamillapalli P., Burch-Smith TM., Czymmek K., Dinesh-Kumar SP. Tobacco leaves were transformed with expression constructs of epitope tagged proteins of interest, using Agroinfiltration using the GV2260 Agrobacterium strain. dinesh-kumar@yale.edu,savithramma.dinesh-kumar@yale.edu dinesh-kumar@yale.edu Solanum lycopersicum (Tomato) cDNA library Cell (0092-8674) 2008 Only protein-protein interactions 8 imex curation caplan-2008-2 Chloroplastic protein NRIP1 mediates innate immune receptor recognition of a viral effector. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Caplan JL., Mamillapalli P., Burch-Smith TM., Czymmek K., Dinesh-Kumar SP. Tobacco leaves were transformed with expression constructs of epitope tagged proteins of interest, using Agroinfiltration using the GV2260 Agrobacterium strain. dinesh-kumar@yale.edu,savithramma.dinesh-kumar@yale.edu dinesh-kumar@yale.edu Solanum lycopersicum (Tomato) cDNA library Cell (0092-8674) 2008 Only protein-protein interactions 8 imex curation caplan-2008-4 Chloroplastic protein NRIP1 mediates innate immune receptor recognition of a viral effector. nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Caplan JL., Mamillapalli P., Burch-Smith TM., Czymmek K., Dinesh-Kumar SP. Tobacco leaves were transformed with expression constructs of epitope tagged proteins of interest, using Agroinfiltration using the GV2260 Agrobacterium strain. dinesh-kumar@yale.edu,savithramma.dinesh-kumar@yale.edu dinesh-kumar@yale.edu Solanum lycopersicum (Tomato) cDNA library Cell (0092-8674) 2008 Only protein-protein interactions 8 imex curation p90211-pro_0000041189 Replicase small subunit RNA-directed RNA polymerase 183 kDa protein protein protein tmob Tobamovirus Ob MAHIQQSMQGALLDTVRGQNSLVNDLAKRRLYDTAVEEFNAKDRRPKINFSKSINEEQTLIVSQAYPEFQITFYNTQLAVHSLAAGLRSLELEYLMMQVPYGSLTYDIGGNFAAHLFKGRDYVHCCMPNLDLRDIMRHENQKDSVATYLSRLKARNKVLPAFQQEAFQRYSERSDEVVCNNTFQCCESNRYSSGGRVYAISLHSLYDIPADELGAALLRKNVHTLYAAFHFAEELLLEVSTVELPTIGGIFSRDGDKINFCFSNESTLNYSHSYSNLLKYVCKTYFPASNRFVYMKEFLITRVNTWFCKFTKLDTYTLYRGVYHRGCDQQEFYSAMEDAWHYKKTLAMLNSERIVLEDHSSVNYWFPKMKDMVIVPLFDVSLETQKRTKKEVIVSKDFVYTVLNHIRTYQAKALTYNNVLSFVESIRSRVIINGVTARSEWDVDKALLQSMAMTFFLITKLSMLKDELLVSKFTLSAKSVHEHVWDEIKRGCGNMFPSLKESLLRKKLISGSAEELEIEVPDMYVTFHDRFVAEYKASVEMPTIDISKDLSEAESYYSALSELSVLENSKDFDLEKFSRMCAINCVNPDIAAKIVVAVLSNESGVTLPFKEPTEGNMAEAMKSGEKDEVLTLGSQTDNTDLTSKSMVISGSLPLCGIASEISCDTFVRNEEINSLEEYHMLAAESVISNKMASIVYSGPLQVQQMQNYVDSLAASLSATVSNLKKLVKDSSVGFQDSLSKVGVFDVRKKMWLIKPTLKNHSWGVVQKFDGKCFLALLSYHNELPICDADWSKVAVSNESMVYSDMAKLRVLRKSIGEMPISVSSAKVTLVDGVPGCGKTKEILRRVNFSEDLVLVPGKEAAAMIRKRANQSGNIVANNDNVKTVDSFLMNLGKGPVCQFKRLFVDEGLMLHPGCVYFLVKLSLCNEAFVFGDTQQIPYINRVQNFPFPQHFSKLIVDETEKRRTTLRCPVDVTHFLNQCYDGAVTTTSKTQRSVGLEVVGGAAVMNPVTKPLKGKIVTFTQSDKLTMLSRGYQDVNTVHEIQGETYEEVSLVRLTPTPIHIISRESPHVLVGLTRHTRCFKYYTVVLDPLVKLVRDLECVSNFLLDVYMVDSVSA 1 1115 p03586-pro_0000041163 Replicase small subunit 183 kDa protein RNA-directed RNA polymerase protein protein tmv Tobacco mosaic virus (strain vulgare) (TMV) TMV Tobacco mosaic virus (strain U1) MAYTQTATTSALLDTVRGNNSLVNDLAKRRLYDTAVEEFNARDRRPKVNFSKVISEEQTLIATRAYPEFQITFYNTQNAVHSLAGGLRSLELEYLMMQIPYGSLTYDIGGNFASHLFKGRAYVHCCMPNLDVRDIMRHEGQKDSIELYLSRLERGGKTVPNFQKEAFDRYAEIPEDAVCHNTFQTMRHQPMQQSGRVYAIALHSIYDIPADEFGAALLRKNVHTCYAAFHFSENLLLEDSYVNLDEINACFSRDGDKLTFSFASESTLNYCHSYSNILKYVCKTYFPASNREVYMKEFLVTRVNTWFCKFSRIDTFLLYKGVAHKSVDSEQFYTAMEDAWHYKKTLAMCNSERILLEDSSSVNYWFPKMRDMVIVPLFDISLETSKRTRKEVLVSKDFVFTVLNHIRTYQAKALTYANVLSFVESIRSRVIINGVTARSEWDVDKSLLQSLSMTFYLHTKLAVLKDDLLISKFSLGSKTVCQHVWDEISLAFGNAFPSVKERLLNRKLIRVAGDALEIRVPDLYVTFHDRLVTEYKASVDMPALDIRKKMEETEVMYNALSELSVLRESDKFDVDVFSQMCQSLEVDPMTAAKVIVAVMSNESGLTLTFERPTEANVALALQDQEKASEGALVVTSREVEEPSMKGSMARGELQLAGLAGDHPESSYSKNEEIESLEQFHMATADSLIRKQMSSIVYTGPIKVQQMKNFIDSLVASLSAAVSNLVKILKDTAAIDLETRQKFGVLDVASRKWLIKPTAKSHAWGVVETHARKYHVALLEYDEQGVVTCDDWRRVAVSSESVVYSDMAKLRTLRRLLRNGEPHVSSAKVVLVDGVPGCGKTKEILSRVNFDEDLILVPGKQAAEMIRRRANSSGIIVATKDNVKTVDSFMMNFGKSTRCQFKRLFIDEGLMLHTGCVNFLVAMSLCEIAYVYGDTQQIPYINRVSGFPYPAHFAKLEVDEVETRRTTLRCPADVTHYLNRRYEGFVMSTSSVKKSVSQEMVGGAAVINPISKPLHGKILTFTQSDKEALLSRGYSDVHTVHEVQGETYSDVSLVRLTPTPVSIIAGDSPHVLVALSRHTCSLKYYTVVMDPLVSIIRDLEKLSSYLLDMYKVDAGTQ This protein is 50-kDa helicase domain of TMV's replicase protein (Interpro identifier IPR000606). 1 1116 tmvrn_nicgu TMV resistance protein N N protein protein nicgu Nicotiana glutinosa (Tobacco) MASSSSSSRWSYDVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFAIVVFSENYATSRWCLNELVKIMECKTRFKQTVIPIFYDVDPSHVRNQKESFAKAFEEHETKYKDDVEGIQRWRIALNEAANLKGSCDNRDKTDADCIRQIVDQISSKLCKISLSYLQNIVGIDTHLEKIESLLEIGINGVRIMGIWGMGGVGKTTIARAIFDTLLGRMDSSYQFDGACFLKDIKENKRGMHSLQNALLSELLREKANYNNEEDGKHQMASRLRSKKVLIVLDDIDNKDHYLEYLAGDLDWFGNGSRIIITTRDKHLIEKNDIIYEVTALPDHESIQLFKQHAFGKEVPNENFEKLSLEVVNYAKGLPLALKVWGSLLHNLRLTEWKSAIEHMKNNSYSGIIDKLKISYDGLEPKQQEMFLDIACFLRGEEKDYILQILESCHIGAEYGLRILIDKSLVFISEYNQVQMHDLIQDMGKYIVNFQKDPGERSRLWLAKEVEEVMSNNTGTMAMEAIWVSSYSSTLRFSNQAVKNMKRLRVFNMGRSSTHYAIDYLPNNLRCFVCTNYPWESFPSTFELKMLVHLQLRHNSLRHLWTETKHLPSLRRIDLSWSKRLTRTPDFTGMPNLEYVNLYQCSNLEEVHHSLGCCSKVIGLYLNDCKSLKRFPCVNVESLEYLGLRSCDSLEKLPEIYGRMKPEIQIHMQGSGIRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLKSLVSLSVSGCSKLESLPEEIGDLDNLRVFDASDTLILRPPSSIIRLNKLIILMFRGFKDGVHFEFPPVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLPELPPELNELHVDCHMALKFIHYLVTKRKKLHRVKLDDAHNDTMYNLFAYTMFQNISSMRHDISASDSLSLTVFTGQPYPEKIPSWFHHQGWDSSVSVNLPENWYIPDKFLGFAVCYSRSLIDTTAHLIPVCDDKMSRMTQKLALSECDTESSNYSEWDIHFFFVPFAGLWDTSKANGKTPNDYGIIRLSFSGEEKMYGLRLLYKEGPEVNALLQMRENSNEPTEHSTGIRRTQYNNRTSFYELING b2c7y6_nicbe NRIP1 protein protein nicbe Nicotiana benthamiana MRILSLPSTSFSLVDCHIPKNLTYGNVSSVTLTPMARSQFQPQKRRNFGNSNRTPGFSWMATVGEKVQVSTVPTSVPVRVALELLQAGHRYLDVRTAEEFSDGHAPGAINIPYMFRIGSGMIKNPNFAEQVLEHFGKDDEIIVGCQLGKRSFMAATDLLAAGFSGVTDIAGGYAAWTENGLPTDS n-nrip1-2 N protein interacts with NPIR1 762144 N/A 762148 unspecified role unspecified role prey prey region enhanced cyan fluorescent protein (ECFP) tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 762149 unspecified role unspecified role bait bait c-terminal tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false The TIR region coordinates are taken from the rerefence provided by the authors , Dinesh-kumar et al (2000). Structure-function analysis of the tobacco mosaic virus resistance gene N. PMID:11121079. Please note therse coordinates differ from the coordinates of the UniProt record. 1B p50-nrip1-4 TMV p50 protein interacts with NPIR1 762144 N/A 762148 unspecified role unspecified role prey prey region enhanced cyan fluorescent protein (ECFP) tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 762150 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3C p50-nrip1-5 TMV-OB p50 protein interacts with NPIR1 762144 N/A 762148 unspecified role unspecified role prey prey region enhanced cyan fluorescent protein (ECFP) tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 762151 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3C n-nrip1-1 N protein interacts with NPIR1 762145 N/A 762148 unspecified role unspecified role prey prey N/A 762149 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false The TIR region coordinates are taken from the rerefence provided by the authors , Dinesh-kumar et al (2000). Structure-function analysis of the tobacco mosaic virus resistance gene N. PMID:11121079. Please note therse coordinates differ from the coordinates of the UniProt record. 1A p50-nrip1-3 TMV p50 protein interacts with NPIR1 762145 N/A 762148 unspecified role unspecified role prey prey N/A 762150 unspecified role unspecified role bait bait physical association physical association false false false 3A p50-nrip1-6 TMV p50 protein interacts with NPIR1 762146 N/A 762148 unspecified role unspecified role neutral component neutral component region C-terminal YFP tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A-x 762150 unspecified role unspecified role neutral component neutral component region N-terminal YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3D n-nrip1-3 N protein interacts with NPIR1 762146 N/A 762148 unspecified role unspecified role neutral component neutral component region C-terminal YFP tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 762150 unspecified role unspecified role ancillary ancillary N/A-x-x-x 762149 unspecified role unspecified role neutral component neutral component region N-terminal YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 4 MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint nekrasov-2006-1 CITRX thioredoxin is a putative adaptor protein connecting Cf-9 and the ACIK1 protein kinase during the Cf-9/Avr9- induced defence response. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nekrasov V., Ludwig AA., Jones JD. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation nekrasov-2006-4 CITRX thioredoxin is a putative adaptor protein connecting Cf-9 and the ACIK1 protein kinase during the Cf-9/Avr9- induced defence response. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Nekrasov V., Ludwig AA., Jones JD. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation nekrasov-2006-2 CITRX thioredoxin is a putative adaptor protein connecting Cf-9 and the ACIK1 protein kinase during the Cf-9/Avr9- induced defence response. nicbe-leaf Nicotiana benthamiana leaf leaf leaf anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nekrasov V., Ludwig AA., Jones JD. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation nekrasov-2006-3 CITRX thioredoxin is a putative adaptor protein connecting Cf-9 and the ACIK1 protein kinase during the Cf-9/Avr9- induced defence response. yeast Saccharomyces cerevisiae Baker's yeast protein three hybrid protein three hybrid trihybrid bridge assay protein 3-hybrid protein tri hybrid trihybrid bridge assay predetermined predetermined participant predetermined Nekrasov V., Ludwig AA., Jones JD. FEBS Lett. (0014-5793) 2006 2009-01-08 Only protein-protein interactions imex curation citx2_nicbe Thioredoxin-like protein CITRX2, chloroplastic CITRX2 Cf-9-interacting thioredoxin 2 protein protein nicbe Nicotiana benthamiana MQAATLSFQPSAPPLQTSAFHFSSKQPNQLKYSLFSYTCPILKRSLLSTQTLSRKSICKPPDVATGKYVREDYLVKKVSAKDIQELIKGERNVPLIIDFYATWCGPCILMAQELEMLAVEYESNALIVKVDTDDEYEFARDMQVRGLPTLYFISPDPNKDAIRTEGLIPIQMMRDIINNDL mint pti1_sollc Pto-interacting protein 1 Pto kinase interactor 1 PTI1 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MSCFSCCDDDDMHRATDNGPFMAHNSAGNNGGQRATESAQRETQTVNIQPIAVPSIAVDELKDITDNFGSKALIGEGSYGRVYHGVLKSGRAAAIKKLDSSKQPDREFLAQVSMVSRLKDENVVELLGYCVDGGFRVLAYEYAPNGSLHDILHGRKGVKGAQPGPVLSWAQRVKIAVGAAKGLEYLHEKAQPHIIHRDIKSSNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVKQCVDARLNTDYPPKAIAKMAAVAALCVQYEADFRPNMSIVVKALQPLLPRPVPS mint q40234_solpi Pto protein protein solpi Solanum pimpinellifolium Currant tomato Lycopersicon pimpinellifolium MGSKYSKATNSINDALSSSYLVPFESYRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFETEIETLSFCRHPHLVSLIGFCDERNEMILIYKYMENGNLKRHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAIIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTVVKGTLGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGDTAVKCLALSSEDRPSMGDVLWKLEYALRLQESVI mint cf9_solpi Receptor-like protein Cf-9 CF-9 protein protein solpi Solanum pimpinellifolium Currant tomato Lycopersicon pimpinellifolium MDCVKLVFLMLYTFLCQLALSSSLPHLCPEDQALSLLQFKNMFTINPNASDYCYDIRTYVDIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLRCSQLQGKFHSNSSLFQLSNLKRLDLSFNNFTGSLISPKFGEFSNLTHLDLSHSSFTGLIPSEICHLSKLHVLRICDQYGLSLVPYNFELLLKNLTQLRELNLESVNISSTIPSNFSSHLTTLQLSGTELHGILPERVFHLSNLQSLHLSVNPQLTVRFPTTKWNSSASLMTLYVDSVNIADRIPKSFSHLTSLHELYMGRCNLSGPIPKPLWNLTNIVFLHLGDNHLEGPISHFTIFEKLKRLSLVNNNFDGGLEFLSFNTQLERLDLSSNSLTGPIPSNISGLQNLECLYLSSNHLNGSIPSWIFSLPSLVELDLSNNTFSGKIQEFKSKTLSAVTLKQNKLKGRIPNSLLNQKNLQLLLLSHNNISGHISSAICNLKTLILLDLGSNNLEGTIPQCVVERNEYLSHLDLSKNRLSGTINTTFSVGNILRVISLHGNKLTGKVPRSMINCKYLTLLDLGNNMLNDTFPNWLGYLFQLKILSLRSNKLHGPIKSSGNTNLFMGLQILDLSSNGFSGNLPERILGNLQTMKEIDESTGFPEYISDPYDIYYNYLTTISTKGQDYDSVRILDSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCGGEDQVTTPAELDQEEEEEDSPMISWQGVLVGYGCGLVIGLSVIYIMWSTQYPAWFSRMDLKLEHIITTKMKKHKKRY mint q84qd9_tobac ACIK1 protein protein tobac Nicotiana tabacum (Common tobacco) Common tobacco MKITWESLVPSCFKGENPKPKAKEIKVVTKQSSFHRISISDFSASTISEDLSISLAGSNLYIFTLQELKVITQNFSSSNFLGEGGFGPVHKGFIDDKLRPGLKAQPVAVKLLDLDGTQGHREWLTEVIFLGQLRHPHLVKLIGYCCEEEHRLLAYEYMPRGSLENQLFRRYSVSLPWSTRMKIAVGAAKGLAFLHEAEKPVIYRDFKASNILLDSDYSAKLSDFGLAKDGPEGDDTHVSTRVMGTQGYAAPEYLMTGHLTAASDVYSFGVVLLELLTGRRSVDKTRPNREQNLVDWARPQLKDPRKLRRIMDPRLEGLYSEEGAQKAALVAYQCLSHRPKARPEMSSVVKTLEPLKDYKDISNMIFVYIAPAEVKEMCKESEKEDQKKTIKKENSPYHQKHHHHHLDRKHRRSPQNSTIYSEKALHKKLGPNSPLRNDFHRA mint citrx2-acik1 501763 q6je37_nicbe 501767 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q84qd9_tobac 501768 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F1B F1D mint acik1-citrx2 501763 q84qd9_tobac 501768 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q6je37_nicbe 501767 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F1C mint cf_9-citrx2 501763 q40235_solpi 501769 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q6je37_nicbe 501767 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F1E mint acik1-citrx2-1 501764 q84qd9_tobac 501768 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified mbp tagged mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q6je37_nicbe 501767 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F3 mint citrx2-pto 501764 q40234_solpi 501770 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q6je37_nicbe 501767 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F3 mint pti1-pto 501764 q40234_solpi 501770 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 pti1_sollc 501771 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate neutral component neutral component purified purified Q41328:p.Lys96Asp mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false F3 mint citrx2-acik1-1 501765 q6je37_nicbe 501767 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q84qd9_tobac 501768 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F2 mint cf_9-acik1 501766 q40235_solpi 501769 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 q6je37_nicbe 501767 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 q84qd9_tobac 501768 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F1G mint