DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ serruto-2010-1 in vitro In vitro protease assay protease assay weight by comassie molecular weight estimation by coomasie staining weight by comassie Serruto D., Spadafina T., Ciucchi L., Lewis LA., Ram S., Tontini M., Santini L., Biolchi A., Seib KL., Giuliani MM., Donnelly JJ., Berti F., Savino S., Scarselli M., Costantino P., Kroll JS., O'Dwyer C., Qiu J., Plaut AG., Moxon R., Rappuoli R., Pizza M., Aricò B. DIP original experiment: DIP-216300X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Neisseria meningitidis GNA2132, a heparin-binding protein that induces protective immunity in humans. Serruto D., Spadafina T., Ciucchi L., Lewis LA., Ram S., Tontini M., Santini L., Biolchi A., Seib KL., Giuliani MM., Donnelly JJ., Berti F., Savino S., Scarselli M., Costantino P., Kroll JS., O'Dwyer C., Qiu J., Plaut AG., Moxon R., Rappuoli R., Pizza M., Aricò B. Only protein-protein interactions imex curation quinternet-2009-1 in vitro In vitro comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Quinternet M., Tsan P., Selme-Roussel L., Jacob C., Boschi-Muller S., Branlant G., Cung MT. DIP original experiment: DIP-132036X Structure (London, England : 1993) 2009 IMEx Formation of the complex between DsbD and PilB N-terminal domains from Neisseria meningitidis necessitates an adaptability of nDsbD. Quinternet M., Tsan P., Selme-Roussel L., Jacob C., Boschi-Muller S., Branlant G., Cung MT. Only protein-protein interactions imex curation quinternet-2009-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Quinternet M., Tsan P., Selme-Roussel L., Jacob C., Boschi-Muller S., Branlant G., Cung MT. DIP original experiment: DIP-132034X Structure (London, England : 1993) 2009 IMEx Formation of the complex between DsbD and PilB N-terminal domains from Neisseria meningitidis necessitates an adaptability of nDsbD. Quinternet M., Tsan P., Selme-Roussel L., Jacob C., Boschi-Muller S., Branlant G., Cung MT. Only protein-protein interactions imex curation quinternet-2009-3 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Quinternet M., Tsan P., Selme-Roussel L., Jacob C., Boschi-Muller S., Branlant G., Cung MT. DIP original experiment: DIP-132037X Structure (London, England : 1993) 2009 IMEx Formation of the complex between DsbD and PilB N-terminal domains from Neisseria meningitidis necessitates an adaptability of nDsbD. Quinternet M., Tsan P., Selme-Roussel L., Jacob C., Boschi-Muller S., Branlant G., Cung MT. Only protein-protein interactions imex curation quinternet-2009-4 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Quinternet M., Tsan P., Selme-Roussel L., Jacob C., Boschi-Muller S., Branlant G., Cung MT. DIP original experiment: DIP-132035X Structure (London, England : 1993) 2009 IMEx Formation of the complex between DsbD and PilB N-terminal domains from Neisseria meningitidis necessitates an adaptability of nDsbD. Quinternet M., Tsan P., Selme-Roussel L., Jacob C., Boschi-Muller S., Branlant G., Cung MT. Only protein-protein interactions imex curation tanabe-2010-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Tanabe M., Nimigean CM., Iverson TM. DIP original experiment: DIP-216398X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for solute transport, nucleotide regulation, and immunological recognition of Neisseria meningitidis PorB. Tanabe M., Nimigean CM., Iverson TM. Only protein-protein interactions imex curation tanabe-2010-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tanabe M., Nimigean CM., Iverson TM. DIP original experiment: DIP-216395X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for solute transport, nucleotide regulation, and immunological recognition of Neisseria meningitidis PorB. Tanabe M., Nimigean CM., Iverson TM. Only protein-protein interactions imex curation tanabe-2010-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Tanabe M., Nimigean CM., Iverson TM. DIP original experiment: DIP-216396X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for solute transport, nucleotide regulation, and immunological recognition of Neisseria meningitidis PorB. Tanabe M., Nimigean CM., Iverson TM. Only protein-protein interactions imex curation tanabe-2010-4 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Tanabe M., Nimigean CM., Iverson TM. DIP original experiment: DIP-216397X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structural basis for solute transport, nucleotide regulation, and immunological recognition of Neisseria meningitidis PorB. Tanabe M., Nimigean CM., Iverson TM. Only protein-protein interactions imex curation trfl_human Lactotransferrin LTF LF Talalactoferrin GIG12 Growth-inhibiting protein 12 protein protein human Homo sapiens Human MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAARRARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYTAGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRKPVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK q7bmv7_neime gna2132 LD10_01095 protein protein neime Neisseria meningitidis MFKRSVIAMACIVALSACGGGGGGSPDVKSADTLSKPAAPVVTEDVGEEVLPKEKKDEEAVSGAPQADTQDATAGKGGQDMAAVSAENTGNGGAATTDNPENKDEGPQNDMPQNAADTDSSTPNHTPAPNMPTRDMGNQAPDAGESAQPANQPDMANAADGMQGDDPSAGENAGNTADQAANQAENNQVGGSQNPASSTNPNATNGGSDFGRINVANGIKLDSGSENVTLTHCKDKVCDRDFLDEEAPPKSEFEKLSDEEKINKYKKDEQRENFVGLVADRVEKNGTNKYVIIYKDKSASSSSARFRRSARSRRSLPAEMPLIPVNQADTLIVDGEAVSLTGHSGNIFAPEGNYRYLTYGAEKLSGGSYALSVQGEPAKGEMLAGTAVYNGEVLHFHMENGRPSPSGGRFAAKVDFGSKSVDGIIDSGDDLHMGTQKFKAVIDGNGFKGTWTENGGGDVSGRFYGPAGEEVAGKYSYRPTDAEKGGFGVFAGKKEQD q9z3b6_neime porB protein protein neime Neisseria meningitidis EVSRVKNQGVKTKTATQIADFGSKIGFKGQEDLGNGMKAIWQLEQKASIAGTNSGWGNRQSFIGLKGGFGTVRVGNLNTVLKDSGDNVNAWESGSNTGDVLGLGTIGRVESREISVRYDSPVFAGFSGSVQYVPRDNANDKDKYTHKQSSRESYHAGLKYENAGFFGQYAGSFAKYADLKDNAERVAVGTTGAHPVKDYQVHRVVAGYDANDLYVSVAGQYEAAKNNDTNPATNGKKLEQTQVAATAAYRFGNVTPRVSYAHGFKAKVNGKKAARYQYDQVIVGADYDFSKRTSALVSVGWLKEGKGVNKTEKTASM tlr2_human Toll-like receptor 2 Toll/interleukin-1 receptor-like protein 4 TLR2 TIL4 protein protein human Homo sapiens Human MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLSNNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDNDRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLKSLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDISKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS a0a425ba78_neime Thiol:disulfide interchange protein DsbD dsbD Protein-disulfide reductase COH33_03365 protein protein neime Neisseria meningitidis MQTNYLSETDSIMKKLICLFAVFLMLCGRAFALDANDLLPPEKAFVPELAVADDGVNVRFRIADGYYMYQAKIVGKTDPADLLGQPSFSKGEEKEDEFFGRQTVYHHEAQVAFPYAKAVGEPYKLVLTYQGCAEAGVCYPPVDTEFDISGNGTYHPQTDEPASAKDRFLQPSSQNGSGALPPPKGDEGGDSRFKLSWDTLNANLLAFFLAGLGLSFTACMYPLLPIVSSIVVGDKKAGKARAFVLSVVYVQGLALTYTLVGIVAGLTGALLTVWLQQAWVVLAASALMVVLALSMFGLFNIQLPNAVQSYFQNQSSRLSGGKIVSVFIMGILSALIVGPCVAPPLAFALGYIGQTGDAVLGGLALYTLALGTGVPLIAIGTFGGHILPKAGDWMNAVKYAFGFILLAVAVYLATPHLPYYLVVALYTLLMLVPAFMLLVNGRRQKRRPKAVAFALGGILLIGGAWFGWQGANGKTTALHHFLTLNPPAEAGKSSEHGKMFADTAALKAAMDTALKEHPDKPVVLDFYADWCISCKEMAAYTLNQPEVHQAVDMERFFQIDVTANTPEHQALLKEYGLFGPPGVFVVRSDGSRSEPLLGFVKADKFIEWYEQNR The sequence has been withdrawn from uniprot. o30390_neime Peptide-methionine (S)-S-oxide reductase pilB protein protein neime Neisseria meningitidis MKHRTFFSLCAKFGCLLALGACSPKIVDAGAATVPHTLSTLKTADNRPASVYLKKDKPTLIKFWASWCPLCLSELGQTEKWAQDAKFSSANLITVASPGFLHEKKDGDFQKWYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKDGDVQRIVKGSINEAQALALIRDPNADLGSLKHSFYKPDTQKKDSKIMNTRTIYLPAAASGAWKPISNASTAWLTRYPYANGNTKNPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQYFFRVVDPTSLNKQGNDTGTQYRSGVYYTDPAEKAVIAAALKREQQKYQLPLVVENEPLKNFYDAEEYHQDYLIKNPNGYCHID gna2132-ltf-1 3203428 N/A 3203429 enzyme enzyme unspecified role unspecified role human Homo sapiens Human N/A 3203430 enzyme target enzyme target substrate substrate unspecified role unspecified role C-terminal domain Region 293-488 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli protein cleavage protein cleavage false false false dsbd-pilb-1 3193977 N/A 3193981 unspecified role unspecified role unspecified role unspecified role Region 20-146 Region 20-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3193982 unspecified role unspecified role unspecified role unspecified role Region 34-176 Region 34-176 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli covalent binding covalent binding false false false dsbd-pilb-2 3193978 N/A 3193981 unspecified role unspecified role unspecified role unspecified role Region 20-146 Region 20-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3193982 unspecified role unspecified role unspecified role unspecified role Region 34-176 Region 34-176 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false dsbd-pilb-3 3193979 N/A 3193981 electron donor electron donor unspecified role unspecified role Region 20-146 Region 20-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3193982 electron acceptor electron acceptor unspecified role unspecified role Region 34-176 Region 34-176 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false dsbd-pilb-4 3193980 N/A 3193981 unspecified role unspecified role unspecified role unspecified role Region 20-146 Region 20-146 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3193982 unspecified role unspecified role unspecified role unspecified role Region 34-176 Region 34-176 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false porb-1 3206442 N/A 3206446 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false porb-2 3206443 N/A 3206446 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false porb-tlr2-1 3206444 N/A 3206447 unspecified role unspecified role unspecified role unspecified role Ectodomain Region 19-588 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris N/A 3206446 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false porb-3 3206445 N/A 3206446 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false