UniProt UniProt http://www.uniprot.org okino-2012-3 Moloney murine leukemia virus integrase and reverse transcriptase interact with PML proteins. human-293ft Homo sapiens HEK293FT cell line 293ft HEK293FT cell line anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Okino Y., Inayoshi Y., Kojima Y., Kidani S., Kaneoka H., Honkawa A., Higuchi H., Nishijima K., Miyake K., Iijima S. Origin of transfected MoMLV constructs according Ref. 9 (PMID:20519390). Purified PML VI used in pull-down exp fig 3B and CoIP fig 6B has been derived from amplified cDNA of NIH3T3 cells; however, there are no available UniProt, cDNA or EST data to reconstruct the mouse protein, it was therefore mapped to the canonical form of mouse PML. miyake@nubio.nagoya-u.ac.jp J. Biochem. (0021-924X) 2012 Only protein-protein interactions imex curation okino-2012-1 Moloney murine leukemia virus integrase and reverse transcriptase interact with PML proteins. human-293ft Homo sapiens HEK293FT cell line 293ft HEK293FT cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Okino Y., Inayoshi Y., Kojima Y., Kidani S., Kaneoka H., Honkawa A., Higuchi H., Nishijima K., Miyake K., Iijima S. Origin of transfected MoMLV constructs according Ref. 9 (PMID:20519390). Purified PML VI used in pull-down exp fig 3B and CoIP fig 6B has been derived from amplified cDNA of NIH3T3 cells; however, there are no available UniProt, cDNA or EST data to reconstruct the mouse protein, it was therefore mapped to the canonical form of mouse PML. miyake@nubio.nagoya-u.ac.jp J. Biochem. (0021-924X) 2012 Only protein-protein interactions imex curation okino-2012-2 Moloney murine leukemia virus integrase and reverse transcriptase interact with PML proteins. mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Okino Y., Inayoshi Y., Kojima Y., Kidani S., Kaneoka H., Honkawa A., Higuchi H., Nishijima K., Miyake K., Iijima S. Origin of transfected MoMLV constructs according Ref. 9 (PMID:20519390). Purified PML VI used in pull-down exp fig 3B and CoIP fig 6B has been derived from amplified cDNA of NIH3T3 cells; however, there are no available UniProt, cDNA or EST data to reconstruct the mouse protein, it was therefore mapped to the canonical form of mouse PML. miyake@nubio.nagoya-u.ac.jp J. Biochem. (0021-924X) 2012 Only protein-protein interactions imex curation okino-2012-4 Moloney murine leukemia virus integrase and reverse transcriptase interact with PML proteins. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Okino Y., Inayoshi Y., Kojima Y., Kidani S., Kaneoka H., Honkawa A., Higuchi H., Nishijima K., Miyake K., Iijima S. Origin of transfected MoMLV constructs according Ref. 9 (PMID:20519390). Purified PML VI used in pull-down exp fig 3B and CoIP fig 6B has been derived from amplified cDNA of NIH3T3 cells; however, there are no available UniProt, cDNA or EST data to reconstruct the mouse protein, it was therefore mapped to the canonical form of mouse PML. miyake@nubio.nagoya-u.ac.jp J. Biochem. (0021-924X) 2012 Only protein-protein interactions imex curation okino-2012-5 Moloney murine leukemia virus integrase and reverse transcriptase interact with PML proteins. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Okino Y., Inayoshi Y., Kojima Y., Kidani S., Kaneoka H., Honkawa A., Higuchi H., Nishijima K., Miyake K., Iijima S. Origin of transfected MoMLV constructs according Ref. 9 (PMID:20519390). Purified PML VI used in pull-down exp fig 3B and CoIP fig 6B has been derived from amplified cDNA of NIH3T3 cells; however, there are no available UniProt, cDNA or EST data to reconstruct the mouse protein, it was therefore mapped to the canonical form of mouse PML. miyake@nubio.nagoya-u.ac.jp J. Biochem. (0021-924X) 2012 Only protein-protein interactions imex curation okino-2012-6 Moloney murine leukemia virus integrase and reverse transcriptase interact with PML proteins. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Okino Y., Inayoshi Y., Kojima Y., Kidani S., Kaneoka H., Honkawa A., Higuchi H., Nishijima K., Miyake K., Iijima S. Co-transfected: human HA-tagged SUMO-1 and mouse PIASy. Origin of transfected MoMLV constructs according Ref. 9 (PMID:20519390). Purified PML VI used in pull-down exp fig 3B and CoIP fig 6B has been derived from amplified cDNA of NIH3T3 cells; however, there are no available UniProt, cDNA or EST data to reconstruct the mouse protein, it was therefore mapped to the canonical form of mouse PML. miyake@nubio.nagoya-u.ac.jp J. Biochem. (0021-924X) 2012 Only protein-protein interactions imex curation okino-2012-7 Moloney murine leukemia virus integrase and reverse transcriptase interact with PML proteins. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Okino Y., Inayoshi Y., Kojima Y., Kidani S., Kaneoka H., Honkawa A., Higuchi H., Nishijima K., Miyake K., Iijima S. Origin of transfected MoMLV constructs according Ref. 9 (PMID:20519390). Purified PML VI used in pull-down exp fig 3B and CoIP fig 6B has been derived from amplified cDNA of NIH3T3 cells; however, there are no available UniProt, cDNA or EST data to reconstruct the mouse protein, it was therefore mapped to the canonical form of mouse PML. miyake@nubio.nagoya-u.ac.jp J. Biochem. (0021-924X) 2012 Only protein-protein interactions imex curation okino-2012-8 Moloney murine leukemia virus integrase and reverse transcriptase interact with PML proteins. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Okino Y., Inayoshi Y., Kojima Y., Kidani S., Kaneoka H., Honkawa A., Higuchi H., Nishijima K., Miyake K., Iijima S. Origin of transfected MoMLV constructs according Ref. 9 (PMID:20519390). Purified PML VI used in pull-down exp fig 3B and CoIP fig 6B has been derived from amplified cDNA of NIH3T3 cells; however, there are no available UniProt, cDNA or EST data to reconstruct the mouse protein, it was therefore mapped to the canonical form of mouse PML. miyake@nubio.nagoya-u.ac.jp J. Biochem. (0021-924X) 2012 Only protein-protein interactions imex curation pias4_mouse E3 SUMO-protein ligase PIAS4 Pias4 Piasg PIASy Protein inhibitor of activated STAT protein 4 Protein inhibitor of activated STAT protein gamma RING-type E3 ubiquitin transferase PIAS4 protein protein mouse Mus musculus Mouse MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKELYETRYAKKSAEPGPQAPRPLDPLALHSMPRTPLSGPTVDYPVLYGKYLNGLGRLPTKTLKPEVRLVKLPFFNMLDELLKPTELVPQSAEKLQESPCIFALTPRQVEMIRNSRELQPGVKAVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSDLLQRLKTIGVKHPELCKALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPVCDKPAAYDQLIIDGLLSKILSECEGADEIEFLAEGSWRPIRAEKEPSCSPQGPILVLGTSDANGLAPASSTPGIGSGLSGPGSAGSGAGAAGSLENGKTGADVVDLTLDSSSSSEDEDEDEDDDEDEDEGPRPKRRCPFQKGLVPAC q8un00_mlvmo Capsid protein p30 gag-pro-pol Gag-Pol polyprotein Matrix protein p15 Nucleocapsid protein p10-Pol RNA-binding phosphoprotein p12 pp12 protein protein mlvmo Moloney murine leukemia virus (MoMLV) MGQTVTTPLSLTLDHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTFNVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWAKPFVHPKPPPPLPPSAPSLPLEPPLSTPSRSSLYPALTPSLGAKPKPQVLSDSEGPLIDLLTEDPPPYRDPRPPPSDGDGNSGEATPAGEAPDPSPMASRLRGRREPPVADSTTSQAFPLRTGGNGQLQYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLITHQPTWDDCQQLLGTLLTGEEKQRVLLEARKAVRGDDGRPTQLPNEVDAAFPLERPDWEYTTQAGRNHLVQYRQLLLAGLQNAGRSPTNLAKVKGITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQETNVAMSFIWQSAPDIGRKLERLEDLKNKTLGDLVREAERIFNKRETPEEREERIRRETEEKEERRRTEDEQKEKERDRRRHREMSKLLATVVSGQRQDRQGGERRRSQLDRDQCAYCKEKGHWAKDCPKKPRGPRGPRPQTSLLTLDDQGGQGQEPPPEPRITLKVGGQPVTFLVDTGAQHSVLTQNPGSLSGKSAWVQGATGGKRYRWTTDRKVHLATGKVTHSFLHVPDCPYPLLGRDLLTKLKAQIHFEGSGAQVMGPMGQPLQVLTLNIEDEYRLHETSKEPDVSLGSTWLSDFPQAWAETGGMGLAVRQAPLIIPLKATSTPVSIKQYPMSQEARLGIKPHIQRLLDQGILVPCQSPWNTPLLPVKKPGTNDYRPVQDLREVNKRVEDIHPTVPNPYNLLSGLPPSHQWYTVLDLKDAFFCLRLHPTSQPLFAFEWRDPEMGISGQLTWTRLPQGFKNSPTLFDEALHRDLADFRIQHPDLILLQYVDDLLLAATSELDCQQGTRALLQTLGDLGYRASAKKAQICQKQVKYLGYLLKEGQRWLTEARKETVMGQPTPKTPRQLREFLGTAGFCRLWIPGFAEMAAPLYPLTKTGTLFDWGPDQQKAYQEIKQALLTAPALGLPDLTKPFELFVDEKQGYAKGVLTQKLGPWRRPVAYLSKKLDPVAAGWPPCLRMVAAIAVLTKDAGKLTMGQPLVILAPHAVEALVKQPPDRWLSNARMTHYQALLLDTDRVQFGPVVALNPATLLPLPEEGLQHNCLDILAEAHGTRPDLTDQPLPDADHTWYTDGSSFLQEGQRKAGAAVTTETEVIWAKALPAGTSAQRAELIALTQALKMAEGKKLNVYTDSRYAFATAHIHGEIYRRRGLLTSEGKEIKNKGEILALLKALFLPKRLSIIHCPGHQKGHSAEARGNRMADQAARKAAITETPDTSTLLIEKSSPYTSEHFHYTVTDIKDLTKLGAIYDKTKKYWVYQGKPVMPDQFTFELLDFLHQLTHLSFSKTKALLERSHSPYYMLNRDRTLKNITETCKACAQVNASKSAVKQGTRVRGHRPGTYWEIDFTEIKPGLYGYKYLLVFIDTFSGWIEAFPTKKETAKVVTKKLLEEIFPRFGMPQVLGTDNGPAFVSKVSQTVADLLGIDWKLHCAYRPQSSGQVERMNRTIKETLTKLTLATGSRDWVLLLPLALYRARNTPGPHGLTPYEILYGAPPPLVNFPDPDMTRVTNSPSLQAHLQALYLVQHEVWRPLAAAYQEQLDRPVVPHPYRVGDTVWVRRHQTKNLEPRWKGPYTVLLTTPTALKVDGIAAWIHAAHVKAADPGGGPSSRLTWRVQRSQNPLKIRLTREAP sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV sumo2_human Small ubiquitin-related modifier 2 SMT3 homolog 2 Sentrin-2 HSMT3 SUMO-3 SUMO2 SMT3H2 SMT3B Ubiquitin-like protein SMT3B protein protein human Homo sapiens Human MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY sumo3_human Small ubiquitin-related modifier 3 SMT3 homolog 1 SUMO-2 SMT3H1 SUMO3 SMT3A Ubiquitin-like protein SMT3A protein protein human Homo sapiens Human MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF pml_human Protein PML PML MYL RNF71 TRIM19 Tripartite motif-containing protein 19 RING finger protein 71 Promyelocytic leukemia protein PP8675 E3 SUMO-protein ligase PML RING-type E3 SUMO transferase PML protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPEEAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS pml_mouse Protein PML Pml protein protein mouse Mus musculus Mouse METEPVSVQKVPAPPGSPCRQQDSALTPTPTMPPPEEPSEDYEHSQSPAEQAIQEEFQFLRCPSCQAQAKCPKLLPCLHTLCSGCLEAPGLQCPICKAPGQADANGEALDNVFFESLQRRLAVFRQIVDAQAACTRCKGLADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDNSVSSFLDSTRKSNIFCSNTNHRNPALTDIYCRGCAKPLCCTCALLDRNHSHLHCDIGEEIQQWHEELGTMTQTLEEQGRTFDSAHAQMCSAIGQLDHARADIEKQIRARVRQVVDYVQAQERELLEAVNDRYQRDYQEIAGQLSCLEAVLQRIRTSGALVKRMKLYASDQEVLDMHSFLRKALCSLRQEEPQNQKVQLLTRGFEEFKLCLQDFISCITQRINAAVASPEAASNQPEAASTHPVTTSTPEDLEQPKEVQSVQAQALELSKTQPVAMVKTVPGAHPVPVYAFSMQGPTYREEASQTVGSMKRKCSHEDCSRKIIKMESTEENEDRLATSSPEQSWPSTFKATSPPHLDGTSNPESTVPEKKILLPNNNHVTSDTGETEERVVVISSSEDSDTENLSSHELDDSSSESSSLQLEGPNSLKALDESLAEPHLEDRTLVFFDLKIDNETQKISQLAAVNRESKFRVLIQPEAFSVYSKAVSLEAGLRHFLSFLTTMHRPILACSRLWGPGLPIFFQTLSDINKLWEFQDTISGFLAVLPLIRERIPGASSFKLGNLAKTYLARNMSERSALASVLAMRDLCCLLEISPGLPLAQHIYSFSSLQCFASLQPLIQASVLPQSEARLLALHNVSFVELLNAYRTNRQEGLKKYVHYLSLQTTPLSSSASTQVAQFLQALSTHMEGLLEGHAPAGAEGKAESKGCLA pias4-gag_pro_pol 1391583 n/a 1391591 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1391592 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false p46 IN sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2A gag_pro_pol-sumo1 1391583 n/a 1391592 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false p46 IN sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1391593 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2B Mouse PIASy (UniProt Ac No Q9JM05) has been cotransfected but not detected in immunocomplexes; probable E3 ligase. gag_pro_pol-sumo2 1391583 n/a 1391594 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1391592 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false p46 IN sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2B Mouse PIASy (UniProt Ac No Q9JM05) has been cotransfected but not detected in immunocomplexes; probable E3 ligase. gag_pro_pol-sumo3 1391583 n/a 1391592 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false p46 IN sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1391595 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2B Mouse PIASy (UniProt Ac No Q9JM05) has been cotransfected but not detected in immunocomplexes; probable E3 ligase. gag_pro_pol-pml 1391584 n/a 1391592 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false p46 IN sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1391596 unspecified role unspecified role prey prey physical association physical association false false false 1A Several bands have been detected with anti-PML antibody interpreted as corresponding to several PML isoforms: I/II, II/IV, VI and VII based on MW. The most intense staining corresponds to isoform VI (UniProt Ac P29590-4). gag_pro_pol-pml-5 1391584 n/a 1391596 unspecified role unspecified role prey prey According MW the most intensive detected band is proposed to correspond to PLM isoform VI (UniProt Ac P29590-4) another band possibly to isoform V (UniProt Ac No P29590-2). n/a 1391592 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false p80 RT sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 6A gag_pro_pol-pml-2 1391585 n/a 1391592 unspecified role unspecified role bait bait infection infection p46 IN sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1391597 unspecified role unspecified role prey prey physical association physical association false false false 1B Based on MW the detected PML protein possibly is a mouse form corresponding to human isoform VI. However, UniProt, cDNA or EST data are not available to support the respective mouse isoform. gag_pro_pol-pml-3 1391586 n/a 1391592 unspecified role unspecified role bait bait purified purified region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false p46 IN sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1391596 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 3A pml-gag_pro_pol 1391587 n/a 1391592 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false p46 IN sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1391597 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3A gag_pro_pol-pml-4 1391588 n/a 1391592 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection p46 IN sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1391596 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4A and B gag_pro_pol-pml-6 1391589 n/a 1391592 unspecified role unspecified role bait bait purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false p80 RT sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293ft Homo sapiens HEK293FT cell line 293ft HEK293FT cell line n/a 1391597 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293ft Homo sapiens HEK293FT cell line 293ft HEK293FT cell line direct interaction direct interaction false false false 6B gag_pro_pol-pml-7 1391590 n/a 1391592 unspecified role unspecified role prey prey purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false p80 RT sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293ft Homo sapiens HEK293FT cell line 293ft HEK293FT cell line n/a 1391597 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293ft Homo sapiens HEK293FT cell line 293ft HEK293FT cell line direct interaction direct interaction false false false 6C