DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ hall-2012-1 metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) ion mobility mass spec ion mobility mass spectrometry of complexes ion mobility mass spec predetermined predetermined participant predetermined Hall Z., Politis A., Robinson CV. DIP original experiment: DIP-250515X Structure (London, England : 1993) 2012 IMEx Structural modeling of heteromeric protein complexes from disassembly pathways and ion mobility-mass spectrometry. Hall Z., Politis A., Robinson CV. Only protein-protein interactions imex curation hall-2012-7 metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) ion mobility mass spec ion mobility mass spectrometry of complexes ion mobility mass spec predetermined predetermined participant predetermined Hall Z., Politis A., Robinson CV. DIP original experiment: DIP-250516X Structure (London, England : 1993) 2012 IMEx Structural modeling of heteromeric protein complexes from disassembly pathways and ion mobility-mass spectrometry. Hall Z., Politis A., Robinson CV. Only protein-protein interactions imex curation hall-2013-7 metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) ion mobility mass spec ion mobility mass spectrometry of complexes ion mobility mass spec predetermined predetermined participant predetermined Hall Z., Hernández H., Marsh JA., Teichmann SA., Robinson CV. DIP original experiment: DIP-254626X Structure (London, England : 1993) 2013 IMEx The role of salt bridges, charge density, and subunit flexibility in determining disassembly routes of protein complexes. Hall Z., Hernández H., Marsh JA., Teichmann SA., Robinson CV. Only protein-protein interactions imex curation lee-2013-11 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lee SJ., McCormick MS., Lippard SJ., Cho US. DIP original experiment: DIP-252096X Nature 2013 IMEx Control of substrate access to the active site in methane monooxygenase. Lee SJ., McCormick MS., Lippard SJ., Cho US. Only protein-protein interactions imex curation lee-2013-12 metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lee SJ., McCormick MS., Lippard SJ., Cho US. DIP original experiment: DIP-252097X Nature 2013 IMEx Control of substrate access to the active site in methane monooxygenase. Lee SJ., McCormick MS., Lippard SJ., Cho US. Only protein-protein interactions imex curation mmob_metca Methane monooxygenase regulatory protein B mmoB MCA1196 protein protein metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) MSVNSNAYDAGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVNVEDRAGYWWIKANGKIEVDCDEISELLGRQFNVYDFLVDVSSTIGRAYTLGNKFTITSELMGLDRKLEDYHA memg_metca Methane monooxygenase component A gamma chain mmoZ Methane hydroxylase MCA1198 protein protein metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) MAKLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSPH mema_metca Methane monooxygenase component A alpha chain mmoX Methane hydroxylase MCA1194 protein protein metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) MALSTATKAATDALAANRAPTSVNAQEVHRWLQSFNWDFKNNRTKYATKYKMANETKEQFKLIAKEYARMEAVKDERQFGSLQDALTRLNAGVRVHPKWNETMKVVSNFLEVGEYNAIAATGMLWDSAQAAEQKNGYLAQVLDEIRHTHQCAYVNYYFAKNGQDPAGHNDARRTRTIGPLWKGMKRVFSDGFISGDAVECSLNLQLVGEACFTNPLIVAVTEWAAANGDEITPTVFLSIETDELRHMANGYQTVVSIANDPASAKYLNTDLNNAFWTQQKYFTPVLGMLFEYGSKFKVEPWVKTWNRWVYEDWGGIWIGRLGKYGVESPRSLKDAKQDAYWAHHDLYLLAYALWPTGFFRLALPDQEEMEWFEANYPGWYDHYGKIYEEWRARGCEDPSSGFIPLMWFIENNHPIYIDRVSQVPFCPSLAKGASTLRVHEYNGQMHTFSDQWGERMWLAEPERYECQNIFEQYEGRELSEVIAELHGLRSDGKTLIAQPHVRGDKLWTLDDIKRLNCVFKNPVKAFN memb_metca Methane monooxygenase component A beta chain mmoY Methane hydroxylase MCA1195 protein protein metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) MSMLGERRRGLTDPEMAAVILKALPEAPLDGNNKMGYFVTPRWKRLTEYEALTVYAQPNADWIAGGLDWGDWTQKFHGGRPSWGNETTELRTVDWFKHRDPLRRWHAPYVKDKAEEWRYTDRFLQGYSADGQIRAMNPTWRDEFINRYWGAFLFNEYGLFNAHSQGAREALSDVTRVSLAFWGFDKIDIAQMIQLERGFLAKIVPGFDESTAVPKAEWTNGEVYKSARLAVEGLWQEVFDWNESAFSVHAVYDALFGQFVRREFFQRLAPRFGDNLTPFFINQAQTYFQIAKQGVQDLYYNCLGDDPEFSDYNRTVMRNWTGKWLEPTIAALRDFMGLFAKLPAGTTDKEEITASLYRVVDDWIEDYASRIDFKADRDQIVKAVLAGLK mmox-mmoy-3 3243022 N/A 3243031 unspecified role unspecified role unspecified role unspecified role metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) N/A 3243032 unspecified role unspecified role unspecified role unspecified role metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) N/A 3243033 unspecified role unspecified role unspecified role unspecified role metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) physical association physical association false false false mmox-mmoy-4 3243028 N/A 3243032 unspecified role unspecified role unspecified role unspecified role metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) N/A 3243033 unspecified role unspecified role unspecified role unspecified role metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) direct interaction direct interaction false false false mmox-mmoy-2 3255655 N/A 3243031 unspecified role unspecified role unspecified role unspecified role metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) N/A 3243032 unspecified role unspecified role unspecified role unspecified role metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) N/A 3243033 unspecified role unspecified role unspecified role unspecified role metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) physical association physical association false false false mmob-mmox-1 3250704 N/A 3250706 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3243031 unspecified role unspecified role unspecified role unspecified role metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) N/A 3243032 unspecified role unspecified role unspecified role unspecified role metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) N/A 3243033 unspecified role unspecified role unspecified role unspecified role metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) physical association physical association false false false mmox-mmoy-1 3250705 N/A 3243031 unspecified role unspecified role unspecified role unspecified role metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) N/A 3243032 unspecified role unspecified role unspecified role unspecified role metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) N/A 3243033 unspecified role unspecified role unspecified role unspecified role metca Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) physical association physical association false false false