MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint lopezpaz-2009-1 Maize AKINbetagamma dimerizes through the KIS/CBM domain and assembles into SnRK1 complexes. in vitro In vitro pull down pull down predetermined predetermined participant predetermined López-Paz C., Vilela B., Riera M., Pagès M., Lumbreras V. FEBS Lett. (0014-5793) 2009 l_pez_paz-2009-1 Maize AKINbetagamma dimerizes through the KIS/CBM domain and assembles into SnRK1 complexes. nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined López-Paz C., Vilela B., Riera M., Pagès M., Lumbreras V. FEBS Lett. (0014-5793) 2009 lopezpaz-2009-2 Maize AKINbetagamma dimerizes through the KIS/CBM domain and assembles into SnRK1 complexes. nicbe Nicotiana benthamiana chromatography chromatography technology column chromatography chromatography predetermined predetermined participant predetermined López-Paz C., Vilela B., Riera M., Pagès M., Lumbreras V. FEBS Lett. (0014-5793) 2009 q8h1l5_maize Non-specific serine/threonine protein kinase protein protein maize Zea mays (Maize) Maize LNVRWKKNGHYNVKCRWCPGFPEVNDTLDASNSFLGDSTIMDNDDANGRLPTVVKFEFQLYKTKDDKYLLDMQRVTGPQLLFLDFCAAFLTKLRVL mint b4fx20_maize ZEAMMB73_Zm00001d044315 100286384 protein protein maize Zea mays (Maize) Maize MDQPEENPEFPSCDAYFEAIQSKKKLPLTLQESLTAAFAQIPVSSFPEVPAGRVIEIPGDTSVIDAVRTLSEQNIRAAPVLNPEPGAPTDWQGRYLGVIDYSAIILWVLENAELAAVALSAASATAAGVGMGAVGAVGVAALGTTGPAAVAGLTAAAIGASVAGGLTAEKGVAKDGLTAADHLGEDFYKVLLQQEPFRSTTVRSIVESYRWSPFVPITLDTSMLTVLLLLSKYRLRNVPVIEPEKPIIRNFITQTGVVKGLQQCKGRDWFDYISALPLSDLGLPFMSIDEVITVNSDDLILEAFKCMKDNKIGGVPVVEGPKRKLVGSVSIRDIRFLLLRPNLFSNFRQLTVIEFMKTLGSTLPDSESNCLVKPPPTCTPDASLGSVIDSIASRITHRIYVVDDDLEVVGVVTLRDVISCFIHEPPGYCDNYLASAMEKLEGKGVRSVEKI mint b4fx20-b4fx20-1 813072 b4fx20_maize AKIN 813075 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false b4fx20_maize AKIN 813075 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false F3A mint b4fx20-b4fx20-2 813072 b4fx20_maize AKIN 813075 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false b4fx20_maize AKIN 813075 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false F3A mint b4fx20-b4fx20-3 813072 b4fx20_maize AKIN 813075 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified b4fx20_maize AKIN 813075 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false F3C mint b4fx20-q8h1l5 813073 q8h1l5_maize SnRK1 813076 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false b4fx20_maize AKIN 813075 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F2B mint b4fx20-b4fx20 813073 b4fx20_maize AKIN 813075 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false b4fx20_maize AKIN 813075 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F5 mint b4fx20-b4fx20-4 813074 b4fx20_maize AKIN 813075 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false b4fx20_maize AKIN 813075 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false F4 mint DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bommert-2013-1 maize Zea mays (Maize) Maize anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bommert P., Je BI., Goldshmidt A., Jackson D. jacksond@cshl.edu Nature 2013 imex curation Only protein-protein interactions imex curation kroeger-2009-1 maize Zea mays (Maize) Maize anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133835X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions imex curation kroeger-2009-2 maize Zea mays (Maize) Maize anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133842X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions imex curation kroeger-2009-3 maize Zea mays (Maize) Maize anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133839X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions imex curation kroeger-2009-4 maize Zea mays (Maize) Maize anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133841X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions imex curation kroeger-2009-5 maize Zea mays (Maize) Maize anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133840X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions imex curation kroeger-2009-6 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133843X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions imex curation kroeger-2009-7 maize Zea mays (Maize) Maize anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133836X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions imex curation kroeger-2009-8 maize Zea mays (Maize) Maize anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133838X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions imex curation kroeger-2009-9 maize Zea mays (Maize) Maize anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133837X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions imex curation kroeger-2009-10 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133844X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions imex curation nji-2019-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction experimental particp experimental participant identification experimental particp Nji E., Gulati A., Qureshi AA., Coincon M., Drew D. ddrew@dbb.su.se Nature structural & molecular biology 2019 Only protein-protein interactions imex curation imex curation nji-2019-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column experimental particp experimental participant identification experimental particp Nji E., Gulati A., Qureshi AA., Coincon M., Drew D. ddrew@dbb.su.se Nature structural & molecular biology 2019 Only protein-protein interactions imex curation imex curation yin-2013-8 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yin P., Li Q., Yan C., Liu Y., Liu J., Yu F., Wang Z., Long J., He J., Wang HW., Wang J., Zhu JK., Shi Y., Yan N. DIP original experiment: DIP-255997X Nature 2013 IMEx Structural basis for the modular recognition of single-stranded RNA by PPR proteins. Yin P., Li Q., Yan C., Liu Y., Liu J., Yu F., Wang Z., Long J., He J., Wang HW., Wang J., Zhu JK., Shi Y., Yan N. Only protein-protein interactions imex curation yin-2013-9 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yin P., Li Q., Yan C., Liu Y., Liu J., Yu F., Wang Z., Long J., He J., Wang HW., Wang J., Zhu JK., Shi Y., Yan N. DIP original experiment: DIP-255998X Nature 2013 IMEx Structural basis for the modular recognition of single-stranded RNA by PPR proteins. Yin P., Li Q., Yan C., Liu Y., Liu J., Yu F., Wang Z., Long J., He J., Wang HW., Wang J., Zhu JK., Shi Y., Yan N. Only protein-protein interactions imex curation yin-2013-10 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yin P., Li Q., Yan C., Liu Y., Liu J., Yu F., Wang Z., Long J., He J., Wang HW., Wang J., Zhu JK., Shi Y., Yan N. DIP original experiment: DIP-255999X Nature 2013 IMEx Structural basis for the modular recognition of single-stranded RNA by PPR proteins. Yin P., Li Q., Yan C., Liu Y., Liu J., Yu F., Wang Z., Long J., He J., Wang HW., Wang J., Zhu JK., Shi Y., Yan N. Only protein-protein interactions imex curation pan-2018-1 maize Zea mays (Maize) Maize 3d-em 3D electron microscopy 3D-EM electron tomog structure determination identification by structure determination identification by structure determination structure determination Pan X., Ma J., Su X., Cao P., Chang W., Liu Z., Zhang X., Li M. xzzhang@ibp.ac.cn Science (New York, N.Y.) 2018 imex curation Only protein-protein interactions imex curation hernandez-2007-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hernandez JM., Feller A., Morohashi K., Frame K., Grotewold E. DIP original experiment: DIP-111397X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The basic helix loop helix domain of maize R links transcriptional regulation and histone modifications by recruitment of an EMSY-related factor. Hernandez JM., Feller A., Morohashi K., Frame K., Grotewold E. Only protein-protein interactions imex curation hernandez-2007-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hernandez JM., Feller A., Morohashi K., Frame K., Grotewold E. DIP original experiment: DIP-111395X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The basic helix loop helix domain of maize R links transcriptional regulation and histone modifications by recruitment of an EMSY-related factor. Hernandez JM., Feller A., Morohashi K., Frame K., Grotewold E. Only protein-protein interactions imex curation hernandez-2007-3 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Hernandez JM., Feller A., Morohashi K., Frame K., Grotewold E. DIP original experiment: DIP-111396X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The basic helix loop helix domain of maize R links transcriptional regulation and histone modifications by recruitment of an EMSY-related factor. Hernandez JM., Feller A., Morohashi K., Frame K., Grotewold E. Only protein-protein interactions imex curation hernandez-2007-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hernandez JM., Feller A., Morohashi K., Frame K., Grotewold E. DIP original experiment: DIP-111398X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The basic helix loop helix domain of maize R links transcriptional regulation and histone modifications by recruitment of an EMSY-related factor. Hernandez JM., Feller A., Morohashi K., Frame K., Grotewold E. Only protein-protein interactions imex curation b6szr1_maize Chlorophyll a-b binding protein, chloroplastic protein protein maize Zea mays (Maize) Maize MASVTARAPVAALRPSASLKSSSSSAAAFLGHSSRLGRTATASPTRRSLKAEAKGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLIPEVLTKAGLINAPQWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKSYSLPPHECGYPGSVFNPLNFAPTLEAKEKELANGRLAMLAFLAFLIQHNVTGKGPFDNLLQHLSDPWHNTIIQTLSG b6suc4_maize Chlorophyll a-b binding protein, chloroplastic ZEAMMB73_Zm00001d046786 protein protein maize Zea mays (Maize) Maize MAAQALLSGRQLLGRPVQSAVSRSSARKAPFVVRASSSPPAKQGADRQLWFASKQSLSYLDGTLPGDYGFDPLGLSDPEGTGGFIEPKWLAYGEVINGRYAMLGAVGAIAPEIFGKMGIIPPETALPWFKTGVIPPAGTYNYWADSYTLFVFNMALMGFAEHRRLQDWYNPGSMGKQYFLGLEKFLAGSGDPSYPGGPLFNPLGFGKTEKEMNELKLKEIKNGRLAMLAILGYFIQGLVTGVGPFQNLLDHLADPVNNNVLTSLKFH b6t892_maize Chlorophyll a-b binding protein, chloroplastic 100282512 ZEAMMB73_Zm00001d021906 protein protein maize Zea mays (Maize) Maize MALVSASSSSTTAVAALPRNGQQRASSSLFSSSSSSSFLVGKTLLRQAEAARPSFAVRAAADSDRPIWFPGSTPPPWLDGSLPGDFGFDPWGLGSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGVLNTPFWYTAGEQQYFTDTTTLFIIELILIGWAEGRRWADIIKPGSVNTDPIFPSNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQAEYTGTGPIDNLFAHLADPGHATIFQAFTPK b6ssn3_maize Chlorophyll a-b binding protein, chloroplastic 100281791 ZEAMMB73_Zm00001d015385 protein protein maize Zea mays (Maize) Maize MVMASSSGLRSCSAVGVPSLLAPSSRSGRLAPFCANATTSGRVTMSAEWMPGQPRPAHLDGSSPGDFGFDPLGLATVPENFERFKESEVYHCRWAMLAVPGILVPEALGLGNWVKAQEWAAVPGGQATYLGAPVPWGTLPTILVIEFVAIAFAEHQRTMEKDPEKKKYPGGAFDPLGFSKDPAKFEEYKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLASHLADPWHNNIGDIIIPRSISP b6txs5_maize protein protein maize Zea mays (Maize) Maize MNSSFIGLKPAAAAAQATAAASSPMKQQQVQVAPQSRRAALLGLAAVFAVTATTAGSAKAGVFDEYLEKSKANKELNDKKRMATSAANFARAYTVEFGSCQFPYNFTGCQDLAKQKKVPFLSDDLEIECEGKEKFKCGSNVFWKW b6stt2_maize PSI subunit V protein protein maize Zea mays (Maize) Maize MATAYAPMASQVMKSSLVVHSRPRGLSGAAALTRRPGRFTVKAIQPEKATYQVVQPINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLLVGPFALTGPLRSTPVHGQAGALGAAGLVAILSVCLTMYGVASFNEGDPSTAPSLTLTGRKKEADKLQTSDGWAKFTGGFFFGGISGVLWAYFLLYVLDLPYFFK b6tr16_maize PSI-K 100286020 Photosystem I subunit X ZEAMMB73_Zm00001d018797 protein protein maize Zea mays (Maize) Maize MASQLSAAVPRFHGLRGYAAPRSAVAALPSVRVGRKRSSSQGIRCDYIGSATNLIMVTTTTLMLFAGRFGLAPSANRKATAGLKLEARDSGLQTGDPAGFTLADTLACGAVGHILGVGIVLGLKNTGALDQIIG psaj_maize Photosystem I reaction center subunit IX psaJ PSI-J protein protein maize Zea mays (Maize) Maize MRDIKTYLSVAPVLSTLWFGALAGLLIEINRLFPDALSFPFF psac_maize Photosystem I iron-sulfur center psaC frxA 9 kDa polypeptide PSI-C Photosystem I subunit VII PsaC protein protein maize Zea mays (Maize) Maize MSHSVKIYDTCIGCTHCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLGPETTRSMALSY b6t1h1_maize Chlorophyll a-b binding protein, chloroplastic protein protein maize Zea mays (Maize) Maize MAASALHQTTSFLGQALVARAAGVDAGDRITMRRTVKSVPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILAKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGN cb21_maize Chlorophyll a-b binding protein 1, chloroplastic CAB1 LHCII type I CAB-1 protein protein maize Zea mays (Maize) Maize MAASTMAISSTAMAGTPIKVGSFGEGRITMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGN b6sqz7_maize protein protein maize Zea mays (Maize) Maize MHLLASCCFTRGSRVSARNPLMSRNLERNGRITCMTFPRDWLRRDLSVIGFGLIGWMGPSSVPAINGNSLTGLFFSSIGQELAHFPTPPPVTSQFWLWLVTWHLGLFIVLTFGQIGFKGRTEDYFEK a0a1d6hy75_maize ZEAMMB73_Zm00001d019518 protein protein maize Zea mays (Maize) Maize MASTNMASATSRFMLAAGVPTGSSGGRVNFASAPNRLGRRLVARADNEAAAAEAAEGEGAVATKPKAEKPPPIGPKRGAKVKILRRESYWYNGIGNVVTVDQDPNTRYPVVVRFNKVNYAGVSTNNYALDEVSEVK b4faw3_maize ZEAMMB73_Zm00001d034543 protein protein maize Zea mays (Maize) Maize MAMATQASAATRHLLAAAWAPAAKPRQLSSQLALPSSSSRGPAPLRASTEEAVEAPKGFVAPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQNFRSIGKNVNPIDVKFTGKATFD a0a059q6u2_maize Photosystem I P700 chlorophyll a apoprotein A2 psaB PSI-B PsaB protein protein maize-1 Zea mays subsp. mays MELRFPRFSQGLAQDPTTRRIWFGIATAHDFESHDDITEERLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFESWIQDPLHVRPIAHAIWDPHFGQPAVEAFTRGGAAGPVNIAYSGVYQWWYTIGLRTNEDLYTGALFLLFLSTLSLIGGWLHLQPKWKPSLSWFKNAESRLNHHLSGLFGVSSLAWTGHLVHVAIPGSRGEYVRWNNFLDVLPYPQGLGPLLTGQWNLYAQNPDSSNHLFGTTQGAGTAILTLLGGFHPQTQSLWLTDIAHHHLAIAFIFLIAGHMYRTNFGIGHSIKDLLEAHTPPGGRLGRGHKGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGAIFFIRDYNPEQNEDNVLARMLDHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTTYGFDILLSSTNGPAFNAGRNIWLPGWLNAVNENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGKFG psaa_maize Photosystem I P700 chlorophyll a apoprotein A1 psaA ps1a1 PSI-A PsaA protein protein maize Zea mays (Maize) Maize MIIRSSEPEVKIAVDRDPIKTSFEEWARPGHFSRTIAKGNPDTTTWIWNLHADAHDFDSHTGDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLYCTAIGALIFASLMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLPINQFLDAGVDPKEIPLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYAEFLSFRGGLDPITGGLWLSDIAHHHLAIAILFLIAGHMYRTNWGIGHGLKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSLNLAMLGSTTIVVAHHMYSMPPYPYLATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDAAIQLQPIFAQWIQNIHAGAPGVTAPGATTSTSLTWGGGELVAIGGKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISVVIFHFSWKMQSDVWGTISDQGIVTHITGGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG psai_maize Photosystem I reaction center subunit VIII psaI protein protein maize Zea mays (Maize) Maize MTDFNLPSIFVPLVGLVFPAIAMTSLFLYVQKNKIV psah_maize Photosystem I reaction center subunit VI, chloroplastic PSAH Light-harvesting complex I 11 kDa protein protein protein maize Zea mays (Maize) Maize MASLAAVSVKPVAIKGLAGSSISGRKLAVARPSARSIRRPRAAAVVAKYGDKSVYFDLDDIGNTTGQWDLYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLLLGGGSLLAYVSASASPDLLPIKKGPQEPPQPGPRGKI b6u534_maize PSI-G 100285458 Photosystem I reaction center subunit V, chloroplastic ZEAMMB73_Zm00001d005996 protein protein maize Zea mays (Maize) Maize MAATSTAAAVLSPPSVAGLRLAPSPGRARVSFRAAPAPARRSVAARAELSSALVISLSTGVSLFLGRFVFFNFQRENVAKQVPAQNGKTHFDAGDERAKEFAALLKSNDPVGFNLVDVLAWGSLGHIVAYYILATSSNGYDPNFF b6sri3_maize PSI-F ZEAMMB73_Zm00001d034283 protein protein maize Zea mays (Maize) Maize MAALAAASTAAFAAKPRARLSVACSAATGDSSSVSLASSVKTFSAALALSSVLLSSAATSPPPAAADIAGLTPCKESKAFAKREKNSIKKLTASLKKYAPDSAPALAINATIEKTKRRFENYGKFGLLCGADGLPHLIVSGDQRHWGEFVTPGLLFLYIAGWIGWVGRSYLIAISGEKKPAMREIIIDVELATRLLPRGFIWPVAAYRELINGDLVVDDKDIGYY a6yrs1_maize rif1 100125653 ZEAMMB73_Zm00001d019922 protein protein maize Zea mays (Maize) Maize MDYGPSDSSGTDDDLPQLPHRSIRGSGRVSGNGRTIVPAGSYARAPTDMEAQIQQLEQEAYCSVLRAFKAQSDAITWEKEGLMTELRKELRVSDKAHRELLNKVNNDNIICSIREWRSTGGLQASMSNNPQPIHDPVPSPTTSGRKRQKTSQSVPALPAPPAMHSQQLATPTQPSSSTARKAVPPVPKGKKTKPGQKVPGGSAAKPMPSSAGPSGRGPHMNRNFPGGSAPEAQAQNVDPLVGRKVMSRWPEDNSFYEAVISDYNAETGLYVLVYDINTANETWEWVDLKEMGPEDIRWKEDDSGIDPVVYLRSRGAPSSGVRKPTGRGGPMPGSGRGRGLPKNMSRKDFPPPQNGVGKRSSDDIDILHTESLIKEVEKVFSVSNPDPQEVEKAKKALKEQEQSLIDAIARLAEASDGESDGLNRGRRNLYAGNQHQANYVDDMPVGDQADAM arlc_maize Anthocyanin regulatory Lc protein LC protein protein maize Zea mays (Maize) Maize MALSASRVQQAEELLQRPAERQLMRSQLAAAARSINWSYALFWSISDTQPGVLTWTDGFYNGEVKTRKISNSVELTSDQLVMQRSDQLRELYEALLSGEGDRRAAPARPAGSLSPEDLGDTEWYYVVSMTYAFRPGQGLPGRSFASDEHVWLCNAHLAGSKAFPRALLAKSASIQSILCIPVMGGVLELGTTDTVPEAPDLVSRATAAFWEPQCPSSSPSGRANETGEAAADDGTFAFEELDHNNGMDDIEAMTAAGGHGQEEELRLREAEALSDDASLEHITKEIEEFYSLCDEMDLQALPLPLEDGWTVDASNFEVPCSSPQPAPPPVDRATANVAADASRAPVYGSRATSFMAWTRSSQQSSCSDDAAPAAVVPAIEEPQRLLKKVVAGGGAWESCGGATGAAQEMSGTGTKNHVMSERKRREKLNEMFLVLKSLLPSIHRVNKASILAETIAYLKELQRRVQELESSREPASRPSETTTRLITRPSRGNNESVRKEVCAGSKRKSPELGRDDVERPPVLTMDAGTSNVTVTVSDKDVLLEVQCRWEELLMTRVFDAIKSLHLDVLSVQASAPDGFMGLKIRAQFAGSGAVVPWMISEALRKAIGKR wtf1_maize Protein WHAT'S THIS FACTOR 1, chloroplastic WTF1 ZEAMMB73_Zm00001d009618 protein protein maize Zea mays (Maize) Maize MDAKLLLPFPFAPAAATRSPKSLFLGAPLPPPPRPPPFPLRLRPRPAAVVAQAAVKRRKEAPFDTVIQRDKKLKLVLKLRNILVAQPDRVMSLRELGRFRRDLGLTRKRRLIALLRRFPGVFDVVEEGVYSLRFRLTPAAERLYLDELRLRNESEGLAVAKLRKLLMMSQEKRILIEKVAHLKHDLGLPPEFRDTVCLRYPQYFRVVRMDRGPALELTHWDPELAVSAAELAEEESRAREAEERNLIIDRPLKFNRVRLPKGLKLTRGEARRIARFKEMPYISPYADFSHLRSGSDEKEKHACGVVHEILSLTVEKRTLVDHLTHFREEFRFSQSLRGMIIRHPDMFYVSFKGDRDSVFLREAYKDSQLVEKNQLVLLKEKMRALVAVPRFPRRAAVGTGEEAEGMNGSLQSRDQVSDEEYDDEDEGLSDMEDLISELSGGKSDADYEWGDGWFGENDDSPPDFGDDEVKVAMKIADGSANGSAPVPVFPDGRPRERW caf1p_maize CRS2-associated factor 1, chloroplastic CAF1 Chloroplastic group IIA intron splicing facilitator CRS2-associated factor 1 protein protein maize Zea mays (Maize) Maize MATARLPSRSFLSPAQQSYPRLPASVRLCLSHHEQPPTGPKRHRRAATSHPAFSAAARGRAKKIPIADTDEPAAGVRVTDRGISYRLDGAPFEFQYSYTEAPRARPVALREAPFMPFGPEATPRPWTGRKPLPKSRKELPEFDSFVLPAPGKKGVKPVQSPGPFLAGMEPRYQSVSREDILGEPLTKEEVSELVKGSLKSKRQLNMGRDGLTHNMLENIHSHWKRKRVCKIKCKGVCTIDMDNICHQLEEKVGGKVIHRQGGVIFLFRGRNYNYRTRPCFPLMLWKPVAPVYPRLVTKVPGGLTPDEATEMRTRGHQLPPICKLGKNGVYANLVNQVREAFEACDLVRVDCSGLNKSDCRKIGAKLKDLVPCILLSFEFEHILMWRGSDWKSSLPPLENSYEVTKVQESFSGKESNEKVTHSGNVLAQIELVSAATSHKNWNLDEGQEKFKDSTDSDMVLNSAKDVPALFHSTGISRTEPSADIPLEYSPLNPVCDIMDPSLNCRSIPTNNCESRALVEKSEHCPDDYNLEMKRKRNDGTKGTVVLNSGSKVEGLLCLLEQAIHSGRALVLSEDELADSDLVYEKSVAFTKSIPRRLVFENTRRKSSARRNVPDNHARTKTHLVENKMLSSPVENKFIVNGGSAMQTIDHGQEFLSDVVHQGTLRVDELAKLLA rnc1_maize Ribonuclease III domain-containing protein RNC1, chloroplastic RNC1 Zm.27802 Chloroplast ribonuclease III domain protein protein protein maize Zea mays (Maize) Maize MGPPAMAFQALTLTPLPFSLHSSSRRVRVLAVAADQTPPPAPPSEPANSPSRLLRELAQRKKAVSPKKKHPPRRFILKPPLDDERLTRRFLSSPQLSLKALPLLSSCLPSAPLSTADRTWMDEYLLEAKQALGYPLAPSETLGEGDDCPARHFDVLFYLAFQHLDPSSERTRMRHVRNGHSRLWFLGQYVLELAFCEFFLQRYPRESPGPMRERVFALIGKKVLPRWLKAASLHNLVFPYDDLDKMIRKDREPPSKAVFWAIFGAIYLCFGMPEVYRVLFEAFGMDPDDESCQPKLRRQLEDVDYVSVEFEKRQLTWQDVAAYRPPPDALFAHPRLFRACVPPGMHRFRGNIWDFDSRPKVMTTLGYPLPMNDRIPEITEARNIELGLGLQLCFLHPSKHKFEHPRFCYERLEYVGQKIQDLVMAERLLMKHLDAPGRWLAEKHRRTLMNKYCGRYLRDKHLQHYIIYGETVQDRFEHNRRLRNPSTTSVQQALHGLAYCVYGKPDVRRLMFEVFDFEQVQPKAV caf2p_maize CRS2-associated factor 2, chloroplastic CAF2 Chloroplastic group IIA intron splicing facilitator CRS2-associated factor 2 protein protein maize Zea mays (Maize) Maize MPPPPPQRPASSHVGRANLFSASPPPLSNRRYPHHRSLPLPPVSPRRRDPKKHSQQPSQEEPTDSGPTRTVTTNPAFRAAHLRTAYRKPVPPAAAAGEGEALLAADPTDAASGRAVVVGPSGLSFRLPGAPFDFQFSYSEAPRAPPLAIREPAFLPFAPPTMPRPWTGKAPLLTKEEKARRRGVRLHTPLGQETPQTVSAHGIMMEVRERRKMDLARVSPGDGRSREEVLGEPLTPSEVRALVKPHISHNRQLNIGRDGLTHNMLEMIHCHWRRQEICKVRCRGVPTVDMKNLCYHLEEKSGGKVIHRVGGVVFLYRGRHYDPKTRPRYPLMLWKPATPVYPKLIKEAPDGFTKEEADEMRRKGRDLLPICKLAKNGIYITLVKDVRDAFEGSDLVKIDCEGLNPSDYKKIGAKLRDLVPCVLLSFDDEQILMHRGKEWKSRYSKPLTLIPKVPKNNLAMTSVMNSSDEVSDANTQVAIREVLRPKMFKLWKSAVDSSLALLLDDAEANNLTPDSLLTLVEEFSVTSQAVEHSFPALLVTNGDASTDSLSAEYMNDEPETSVAGNEEGQLEQSPDLRDDEHFDVDMFERLESSVPLGSLPIDSMIERLNSE cfm3_maize CRM-domain containing factor CFM3, chloroplastic/mitochondrial CFM3 Protein CRM FAMILY MEMBER 3 protein protein maize Zea mays (Maize) Maize MAMASSPACHFRHPPRLRLLLPLSTSAPHPWLYSWSHPRQRGRLRAPPAALDLRPEPSPSSDSDDEDAVGASRSSGRSTMSLILSRLRRAGYSGEDPRAAAPPHPPRGSVEDVFRADDGVLPNARGGFDADDEERALGDARFPWERPMPPPEAAPRSARSPTWMAELTLPAAELRRLRHAAIRIKSRTKVGGAGVTREIVEKIKEKWKTEEVVRVKVSGTPALNMRLFHEILERKTGGLVIWRSGTSVSLYRGVDYDEPEPTKKSKKNSQSLAMDFPIKGSSNPSLLPTETANSVRDSNVALVSNAAKEELVVQAPEIKYEDEIDKLLDELGPRYTDWPGSDPLPVDADLLPANMPGYKPPFRVLPYGVRPSLSRRDTTNLRRLARGLPPHFALGRSRQLQGLANAMVKLWEKSSIAKIALKRGVQLTTSERMAEDIKKLTGGVMLSRNNEFIVFYRGKDFLSSELAEVLLERERLAKSLQDEEEARRKAASYFSSAETYAQPTVAGTLGETLEANSKYGTKHDENHADKMARTIEAARHADLVRKLEWKLSLAQKKMEKAERVLGKVETALRPTEDSRPPETITDEERFMFRKLGLRMKAFLLLGRRGVFDGTIENMHLHWKYRELVKILVKAKSFADVKRIALSLEAESGGILVSVDKVSKGYAIVVFRGKNYRRPSSLRPRNLLSKRKALARSIELQRHQALSRHFAKLNRKVERLKAELVQMEDVKEQGDEELYAKLDAAYSSDDEDMEDEDDEAYLKRFDNEVAGATADDDGSDDYTSAADEADYPDSDDEAGDCSEDEGEDDEDEAAAGVSDAGFHGEVVGFSSDTDRRNHDVNEY a7udm2_maize CFM2 protein protein maize Zea mays (Maize) Maize VGSTLDPSWATGDGEASSTSRQRRRGRGRDASGSPSAPPSAAELALPRDELRRLQGIGIRVRKRLKVGKAGITEGIVNGIHERWRNAEVVKLRCEDVWAMNMRRTHEILERKTGGLVIWRSGSTIILYRGTNYTYPYFHHSERVDSFLDKESSDQSNSGDEDETSSQHGSSHEKSSENPVVACAEQIHVGEGNSQTIEYLNQSLSREKDTNHPVSSIKRLVFDADEGNLDIRAGNPNEQHVRLQENTHPDSPNKFGPRDRSSLVAGVGSQNKFRLQLPGEVKLAEEADKLLDGLGPRFSGWWGYDPVPVDADLLPAIVPGYRRPFRLLPSGVPPKLTDREMTILRRLAHALPFHYALGRSSNLQGLAASMIKLWERCEVAKIALKRDAHNTDSELITEEVKELTGGTLLSRDKESIVFYRGKDFLPPAVSLAIEKRRKLGSSTIYKAKPGIEESMPTQNDSVLKVSSDVSVHVREEGTSVTENRAESLNTVAKDVETRLSQAIAEKAKAEKLIEELEKASPLSKAEVRETISEDERYMLRKVGLKMKQFLLLGRRGVFDGTIENMHLHWKYRELVKIICKEHRLEDVEYAARTLEAESGGILVAVEKVSKGHAIIVYRGKNYKRPSKLRPKTLLSKRDALKRSLENQRCKSLKVHVLKLSKNIDYLRDQMNSSYYHKDMHDPSVNSVTLQQQDEEMPEVAPMSSEPEVEKWTSVEIDRALDLTKSGVPVEDMQSKVCFNKLEDDSSATAGPCLTGSSIAASSYNLIRHQNQRSSTVTSSPDGRYEGAPSKVVDAPKLDAESLSVSPLRAAPLSNQERLVLRKQALQMKKRPVLSIGRNNAITGVAKTIKTHFKKHPLAIVNIKNRADGTPIQQLISELEEATGSVLVSRETNKVILYRGWGAEVAQKSSRESSTDEGEKEVISPQLLEAIRLECGLLPADSG crs1_maize Chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic CRS1 Chloroplastic RNA splicing factor 1 Protein CHLOROPLAST RNA SPLICING 1 protein protein maize Zea mays (Maize) Maize MAPPPLPLFSPSLKAPPPPPWLHGSSTQSRDSAPPVPPLPAEATPSKFRIDSPKPAPARKNTKTAAKPLTAGVPGGRTHRAVLGIIRRVRSLELSDAPSPNSVHTSNSGAAAAAFHLTIELSPPREPGQYVVEKEKSRAVPWAAARDEGLKVALRREKKPREPTRAETELETHELRRLRRLARGIGRWARAKKAGVTDEVVKEVRREWASGEELAAVRIVEPLRRSMDRAREILEIKTGGLVVWTKGDMHFVYRGSKYQQNAKHSHTFLTNVHKDDAFQENDQSICGQKDEEPVKGTLYEREVNRLLDTLGPRFVDWWWDTPLPVDADLLPEFVPGSKTPYRLCPPGVRPTLADEELTYLRKLARLLPTHFALGRNTRLQGLAAAILKLWEKSLIAKIAVKIGIQNTNNEQMAWNLKHLTGGTVILRNKDFIILYRGKDFLPGGVAQTVIQREAQVHDEQVKEEEARLKAVDSLQMVGELSEESSLGTFREYQGFHAKFVHENTENSNTMIELEAEKYRLEKELKDHEWKLSVLNKKIERSNQALAKLHSSWSPSEQSADREHLTEEEKIMFRRIGRKMDGLVLLGRRGIFDGVIEEIHQHWKHKEVVKVITKQNQTRQIMYAASLLEVETGGILIAVEKLTTSHAIILYRGKNYRRPAKSSFSNLLTKREALRRSIEVQRRGSMKYFVRERQKSILELKRKLRYVTRQIRYRTP b6tws6_maize 100284718 ZEAMMB73_Zm00001d027886 protein protein maize Zea mays (Maize) Maize MSVLTCVIESMGSSCSRSHSFDEAEAAENAKSADIDRRILQETKAEQHIHKLLLLGAGESGKSTIFKQIKLLFQTGFDEAELRSYTSVIHANVYQTIKILYEGAKELAQVEPDSSKYVLSPDNQEIGEKLSEIGARLEYPSLNKERVQDVRKLWQDPAIQETYSRGSILQVPDCAQYFMENLDKLSEEDYVPTKEDVLHARVRTNGVVETQFSPLGESKRGGEVYRLYDVGGQRNERRKWIHLFEGVNAVIFCAAISEYDQMLFEDETKNRMMETKELFDWVLKQRCFEKTSFMLFLNKFDIFERKIQKVPLSVCEWFKDYQPTAPGKQEVEHAYEFVKKKFEELYFQSSKPDRVDRVFKIYRTTALDQKLVKKTFKLIDESMRRSREGT fea2_maize Leucine-rich repeat receptor-like protein FASCIATED EAR2 CLAVATA2-like protein ZEAMMB73_546581 FEA2 protein protein maize Zea mays (Maize) Maize MLTATPLPHQLLATFLLVLASATQPAVPASTDRAALLAFRASLSPPSRAALSSWSGPLSPSWLGVSLHPATAPAPSVTTPSVAELSLRGLNLTGVIPAAPLALLRRLRTLDLSANALSGELPCSLPRSLLALDLSRNALSGAVPTCLPSSLPALRTLNLSANFLRLPLSPRLSFPARLAALDLSRNAISGAVPPRIVADPDNSALLLLDLSHNRFSGEIPAGIAAVRSLQGLFLADNQLSGDIPPGIGNLTYLQVLDLSNNRLSGSVPAGLAGCFQLLYLQLGGNQLSGALRPELDALASLKVLDLSNNKISGEIPLPLAGCRSLEVVDLSGNEISGELSSAVAKWLSLKFLSLAGNQLSGHLPDWMFSFPLLQWLDLSSNKFVGFIPDGGFNVSEVLNGGGGQGTPSESVLPPQLFVSASVDTVSWQLDLGYDVQATTGIDLSGNELCGEIPEGLVDMKGLEYLNLSCNYLAGQIPAGLGGMGRLHTLDFSHNGLSGEVPPGIAAMTVLEVLNLSYNSLSGPLPTTKFPGALAGNPGICSGKGCSENARTPEGKMEGSNHRGWLGGWHGENGWVSLGAFCISTMTSFYVSLATLLCSSNARNFVFRPVRVEY ppr10_maize Pentatricopeptide repeat-containing protein 10, chloroplastic PPR10 ZEAMMB73_Zm00001d036698 protein protein maize Zea mays (Maize) Maize MEATGRGLFPNKPTLPAGPRKRGPLLPAAPPPPSPSSLPLDSLLLHLTAPAPAPAPAPRRSHQTPTPPHSFLSPDAQVLVLAISSHPLPTLAAFLASRRDELLRADITSLLKALELSGHWEWALALLRWAGKEGAADASALEMVVRALGREGQHDAVCALLDETPLPPGSRLDVRAYTTVLHALSRAGRYERALELFAELRRQGVAPTLVTYNVVLDVYGRMGRSWPRIVALLDEMRAAGVEPDGFTASTVIAACCRDGLVDEAVAFFEDLKARGHAPCVVTYNALLQVFGKAGNYTEALRVLGEMEQNGCQPDAVTYNELAGTYARAGFFEEAARCLDTMASKGLLPNAFTYNTVMTAYGNVGKVDEALALFDQMKKTGFVPNVNTYNLVLGMLGKKSRFTVMLEMLGEMSRSGCTPNRVTWNTMLAVCGKRGMEDYVTRVLEGMRSCGVELSRDTYNTLIAAYGRCGSRTNAFKMYNEMTSAGFTPCITTYNALLNVLSRQGDWSTAQSIVSKMRTKGFKPNEQSYSLLLQCYAKGGNVAGIAAIENEVYGSGAVFPSWVILRTLVIANFKCRRLDGMETAFQEVKARGYNPDLVIFNSMLSIYAKNGMYSKATEVFDSIKRSGLSPDLITYNSLMDMYAKCSESWEAEKILNQLKCSQTMKPDVVSYNTVINGFCKQGLVKEAQRVLSEMVADGMAPCAVTYHTLVGGYSSLEMFSEAREVIGYMVQHGLKPMELTYRRVVESYCRAKRFEEARGFLSEVSETDLDFDKKALEAYIEDAQFGR b4fz94_maize 100274139 ZEAMMB73_Zm00001d046060 protein protein maize Zea mays (Maize) Maize MQWYLVAALLTILTSSQGILTTLSQSNGKYNYDYATIPFLAELFKLSVSGFFLWKECHSSSPPRMTKEWRSVRLYVVPSVIYLIHNNVQFATLTYVDPSTYQIMGNLKIVTTGILFRLVLKRKLSNIQWMAIVLLAVGTTTSQVKGCGDSPCDSLFSAPLEGYLLGILSACLSALAGVYTEYLMKKNNDSLYWQNVQLYTFGVIFNMGWLIYGDFKAGFELGPWWQRLFNGYSITTWMVVFNLGSTGLLVSWLMKYSDNIVKVYSTSMAMLLTMVLSIYLFSVKATIQLFLGIIICIISLQMYFMPVHMLIELPQTLPVTSK 100284718-fea2-1 3468750 N/A 3468751 unspecified role unspecified role prey prey native native N/A 3468752 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed YFP tag YFP tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 3D, Extended Data Fig 5E caf1-b6ttv8_maize-1 3185229 N/A 3185239 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185240 unspecified role unspecified role bait bait maize Zea mays (Maize) Maize physical association physical association false false false cfm3-b6ttv8_maize-1 3185230 N/A 3185241 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185242 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185240 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185239 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185243 unspecified role unspecified role bait bait maize Zea mays (Maize) Maize association association false false false caf2-b6ttv8_maize-1 3185231 N/A 3185243 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185244 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185241 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185240 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185239 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185242 unspecified role unspecified role bait bait maize Zea mays (Maize) Maize association association false false false cfm2-caf2-1 3185232 N/A 3185242 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185244 unspecified role unspecified role bait bait maize Zea mays (Maize) Maize physical association physical association false false false rnc1-b6ttv8_maize-1 3185233 N/A 3185243 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185242 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185240 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185239 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185241 unspecified role unspecified role bait bait maize Zea mays (Maize) Maize association association false false false b6ttv8_maize-rnc1-1 3185234 N/A 3185239 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3185241 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false caf2-b6ttv8_maize-2 3185235 N/A 3185239 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185242 unspecified role unspecified role bait bait maize Zea mays (Maize) Maize physical association physical association false false false caf1-b6ttv8_maize-2 3185236 N/A 3185243 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185241 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185242 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185239 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185240 unspecified role unspecified role bait bait maize Zea mays (Maize) Maize association association false false false b6ttv8_maize-caf1-1 3185237 N/A 3185243 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185245 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185241 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185242 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185240 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize N/A 3185239 unspecified role unspecified role bait bait maize Zea mays (Maize) Maize association association false false false b6ttv8_maize-rnc1-2 3185238 N/A 3185239 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3185241 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false 100274139-1 3636770 N/A 3636772 structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified strep tag strep tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast Stoichiometry: 2.0 direct interaction direct interaction false false false Fig. 1, Table 1, Supplementary Figure 2 100274139-2 3636771 N/A 3636772 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified strep tag strep tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast Stoichiometry: 2.0 physical association physical association false false false Supplementary Figure 1a ppr10-1 3259749 N/A 3259752 unspecified role unspecified role unspecified role unspecified role Region 37-786 Region 37-786 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ppr10-2 3259750 N/A 3259752 unspecified role unspecified role unspecified role unspecified role Region 61-786 Region 61-786 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ppr10-3 3259751 N/A 3259752 unspecified role unspecified role unspecified role unspecified role Region 69-786 Region 69-786 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false 100191984-100281791 3440783 N/A 3440784 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 N/A 3440785 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 N/A 3440786 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 2.0 N/A 3440787 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 N/A 3440788 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 N/A 3440789 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 N/A 3440790 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 N/A 3440791 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 N/A 3440792 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 N/A 3440793 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 N/A 3440794 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 N/A 3440795 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 N/A 3440796 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 N/A 3440797 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 N/A 3440798 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 N/A 3440799 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 N/A 3440800 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 N/A 3440801 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 N/A 3440802 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 N/A 3440803 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize Stoichiometry: 1.0 physical association physical association false false false Figure 1 rif1-rif1-1 3163167 N/A 3163171 unspecified role unspecified role prey prey Binding region 49-114 Binding region 49-114 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3163171 unspecified role unspecified role bait bait Binding region 49-114 Binding region 49-114 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false lc-rif1-1 3163168 N/A 3163172 unspecified role unspecified role bait bait Binding region 411-462 Binding region 411-462 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3163171 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false lc-rif1-2 3163169 N/A 3163172 unspecified role unspecified role bait bait Rgion 411-610 Rgion 411-610 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3163171 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false lc-rif1-3 3163170 N/A 3163172 unspecified role unspecified role bait bait Rgion 411-610 Rgion 411-610 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3163171 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ braun-1997-3 Interaction of the maize and Arabidopsis kinase interaction domains with a subset of receptor-like protein kinases: implications for transmembrane signaling in plants. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Braun DM., Stone JM., Walker JC. The identity of the Maize KAPP interacting protein called KBK1 in the text could not be identified unambiguously and was therefore not curated. A cDNA library of Maize leaf was screened with a radiolabelled probe made from the KI region of the Maize KAPP gene. braun@biosci.mbp.missouri.edu Maize leaf cDNA library. Plant J. (0960-7412) 1997 Only protein-protein interactions imex curation braun-1997-2 Interaction of the maize and Arabidopsis kinase interaction domains with a subset of receptor-like protein kinases: implications for transmembrane signaling in plants. in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Braun DM., Stone JM., Walker JC. The identity of the Maize KAPP interacting protein called KBK1 in the text could not be identified unambiguously and was therefore not curated. A cDNA library of Maize leaf was screened with a radiolabelled probe made from the KI region of the Maize KAPP gene. braun@biosci.mbp.missouri.edu Maize leaf cDNA library. Plant J. (0960-7412) 1997 Only protein-protein interactions imex curation braun-1997-1 Interaction of the maize and Arabidopsis kinase interaction domains with a subset of receptor-like protein kinases: implications for transmembrane signaling in plants. in vitro In vitro biochemical biochemical nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Braun DM., Stone JM., Walker JC. The identity of the Maize KAPP interacting protein called KBK1 in the text could not be identified unambiguously and was therefore not curated. A cDNA library of Maize leaf was screened with a radiolabelled probe made from the KI region of the Maize KAPP gene. braun@biosci.mbp.missouri.edu Maize leaf cDNA library. Plant J. (0960-7412) 1997 Only protein-protein interactions imex curation fritze-2004-1 The crystal structures of Zea mays and Arabidopsis 4-hydroxyphenylpyruvate dioxygenase. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Fritze IM., Linden L., Freigang J., Auerbach G., Huber R., Steinbacher S. fritze@biochem.mpg.de Plant Physiol. (0032-0889) 2004 Only protein-protein interactions imex curation pan-1999-1 Specific interactions with TBP and TFIIB in vitro suggest that 14-3-3 proteins may participate in the regulation of transcription when part of a DNA binding complex. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Pan S., Sehnke PC., Ferl RJ., Gurley WB. The VP16 protein mentioned in this study could not be unambiguously identified and therefore interactions involving this protein were not curated. wgurley@micro.ifas.ufl.edu Plant Cell (1040-4651) 1999 Only protein-protein interactions imex curation lara-2003-2 Synergistic activation of seed storage protein gene expression in Arabidopsis by ABI3 and two bZIPs related to OPAQUE2. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa predetermined predetermined participant predetermined Lara P., Onate-Sanchez L., Abraham Z., Ferrandiz C., Diaz I., Carbonero P., Vicente-Carbajosa J. Assays were carried out at 23C and 30C. jvicente@bit.etsia.upm.es. J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation szymanski-1998-1 Control of GL2 expression in Arabidopsis leaves and trichomes. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Szymanski DB., Jilk RA., Pollock SM., Marks MD. dmarks@biosci.cbs.umn.edu Development (0950-1991) 1998 Only protein-protein interactions imex curation li-1999b-2 Kinase interaction domain of kinase-associated protein phosphatase, a phosphoprotein-binding domain. in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Li J., Smith GP., Walker JC. walkerj@missouri.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 Only protein-protein interactions imex curation li-1999b-3 Kinase interaction domain of kinase-associated protein phosphatase, a phosphoprotein-binding domain. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Li J., Smith GP., Walker JC. walkerj@missouri.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 Only protein-protein interactions imex curation li-1999b-1 Kinase interaction domain of kinase-associated protein phosphatase, a phosphoprotein-binding domain. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag western anti tag western blot anti tag western Li J., Smith GP., Walker JC. walkerj@missouri.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 Only protein-protein interactions imex curation lister-2007-3 Functional definition of outer membrane proteins involved in preprotein import into mitochondria yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lister R., Carrie C., Duncan O., Ho LH., Howell KA., Murcha MW., Whelan J. seamus@cyllene.uwa.edu.au Plant Cell (1040-4651) 2007 Only protein-protein interactions imex curation lister-2007-2 Functional definition of outer membrane proteins involved in preprotein import into mitochondria in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Lister R., Carrie C., Duncan O., Ho LH., Howell KA., Murcha MW., Whelan J. It was not possible to unambiguously identify the protein described as Tim23 (in this case no accession number was provided). seamus@cyllene.uwa.edu.au Plant Cell (1040-4651) 2007 Only protein-protein interactions imex curation kurisu-2001-1 Structure of the electron transfer complex between ferredoxin and ferredoxin-NADP(+) reductase. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kurisu G., Kusunoki M., Katoh E., Yamazaki T., Teshima K., Onda Y., Kimata-Ariga Y., Hase T. PDBe - Data obtained from the Protein Data Bank Europe kurisu@protein.osaka-u.ac.jp Nat. Struct. Biol. (1072-8368) 2001 ali-2009-4 Specific recognition of a multiply phosphorylated motif in the DNA repair scaffold XRCC1 by the FHA domain of human PNK. in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Ali A.A., Jukes R.M., Pearl L.H., Oliver A.W. antony.oliver@icr.ac.uk,laurence.pearl@icr.ac.uk Nucleic Acids Res. (0305-1048) 2009 Only protein-protein interactions imex curation phelps_durr-2005-1 Maize rough sheath2 and its Arabidopsis orthologue ASYMMETRIC LEAVES1 interact with HIRA, a predicted histone chaperone, to maintain knox gene silencing and determinacy during organogenesis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Phelps-Durr TL., Thomas J., Vahab P., Timmermans MC. Chromatin - Epigenetic interactions resulting in chromatin modulation 2 timmerma@cshl.edu maize cDNA library screened Plant Cell (1040-4651) 2005 phelps_durr-2005-2 Maize rough sheath2 and its Arabidopsis orthologue ASYMMETRIC LEAVES1 interact with HIRA, a predicted histone chaperone, to maintain knox gene silencing and determinacy during organogenesis. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Phelps-Durr TL., Thomas J., Vahab P., Timmermans MC. Chromatin - Epigenetic interactions resulting in chromatin modulation 2 timmerma@cshl.edu maize cDNA library screened Plant Cell (1040-4651) 2005 lee-1999a-1 WEREWOLF, a MYB-related protein in Arabidopsis, is a position-dependent regulator of epidermal cell patterning. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee MM., Schiefelbein J. schiefel@umich.edu Cell (0092-8674) 1999 skirpan-2008-4 Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Skirpan A., Wu X., McSteen P. pcm11@psu.edu Maize (Zea mays) (line OH43) immature tassel cDNA library. Plant J. (0960-7412) 2008 skirpan-2008-1 Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Skirpan A., Wu X., McSteen P. pcm11@psu.edu Maize (Zea mays) (line OH43) immature tassel cDNA library. Plant J. (0960-7412) 2008 skirpan-2008-2 Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Skirpan A., Wu X., McSteen P. pcm11@psu.edu Maize (Zea mays) (line OH43) immature tassel cDNA library. Plant J. (0960-7412) 2008 skirpan-2008-3 Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Skirpan A., Wu X., McSteen P. pcm11@psu.edu Maize (Zea mays) (line OH43) immature tassel cDNA library. Plant J. (0960-7412) 2008 skirpan-2008-5 Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. allce Allium cepa (Onion) Onion fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Skirpan A., Wu X., McSteen P. Onion epidermal tissue was transformed with constructs expressing fluorescent tag fused to proteins of interest in this assay. pcm11@psu.edu Maize (Zea mays) (line OH43) immature tassel cDNA library. Plant J. (0960-7412) 2008 q3v810_maize pac1 103627556 WD40.1 ZEAMMB73_Zm00001d017616 protein protein maize Zea mays (Maize) Maize MDPPKPPSSVASSSGPETPNPHAFTCELPHSIYALAFSPVAPVLASGSFLEDLHNRVSLLSFDPVRPSAASFRALPALSFDHPYPPTKLQFNPRAAAPSLLASSADTLRIWHTPLDDLSDTAPAPELRSVLDNRKASSEFCAPLTSFDWNEVEPRRIGTASIDTTCTVWDIDRGVVETQLIAHDKAVHDIAWGEAGVFASVSADGSVRVFDLRDKEHSTIVYESPRPDTPLLRLAWNRSDLRYMAALLMDSSAVVVLDIRAPGVPVAELHRHRACANAVAWAPQATRHLCSAGDDGQALIWELPETAAAVPAEGIDPVLVYDAGAEINQLQWAAAHPDWMAIAFENKVQLLRV wer_arath Transcription factor WER Protein WEREWOLF Myb-related protein 66 WER MYB66 At5g14750 T9L3.50 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRKKVSSSGDEGNNEYKKGLWTVEEDKILMDYVKAHGKGHWNRIAKKTGLKRCGKSCRLRWMNYLSPNVKRGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLGIKDQKTKQSNGDIVYQINLPNPTETSEETKISNIVDNNNILGDEIQEDHQGSNYLSSLWVHEDEFELSTLTNMMDFIDGHCF clv1_arath Receptor protein kinase CLAVATA1 CLV1 T4O12.5 At1g75820 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAMRLLKTHLLFLHLYLFFSPCFAYTDMEVLLNLKSSMIGPKGHGLHDWIHSSSPDAHCSFSGVSCDDDARVISLNVSFTPLFGTISPEIGMLTHLVNLTLAANNFTGELPLEMKSLTSLKVLNISNNGNLTGTFPGEILKAMVDLEVLDTYNNNFNGKLPPEMSELKKLKYLSFGGNFFSGEIPESYGDIQSLEYLGLNGAGLSGKSPAFLSRLKNLREMYIGYYNSYTGGVPPEFGGLTKLEILDMASCTLTGEIPTSLSNLKHLHTLFLHINNLTGHIPPELSGLVSLKSLDLSINQLTGEIPQSFINLGNITLINLFRNNLYGQIPEAIGELPKLEVFEVWENNFTLQLPANLGRNGNLIKLDVSDNHLTGLIPKDLCRGEKLEMLILSNNFFFGPIPEELGKCKSLTKIRIVKNLLNGTVPAGLFNLPLVTIIELTDNFFSGELPVTMSGDVLDQIYLSNNWFSGEIPPAIGNFPNLQTLFLDRNRFRGNIPREIFELKHLSRINTSANNITGGIPDSISRCSTLISVDLSRNRINGEIPKGINNVKNLGTLNISGNQLTGSIPTGIGNMTSLTTLDLSFNDLSGRVPLGGQFLVFNETSFAGNTYLCLPHRVSCPTRPGQTSDHNHTALFSPSRIVITVIAAITGLILISVAIRQMNKKKNQKSLAWKLTAFQKLDFKSEDVLECLKEENIIGKGGAGIVYRGSMPNNVDVAIKRLVGRGTGRSDHGFTAEIQTLGRIRHRHIVRLLGYVANKDTNLLLYEYMPNGSLGELLHGSKGGHLQWETRHRVAVEAAKGLCYLHHDCSPLILHRDVKSNNILLDSDFEAHVADFGLAKFLVDGAASECMSSIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGKKPVGEFGEGVDIVRWVRNTEEEITQPSDAAIVVAIVDPRLTGYPLTSVIHVFKIAMMCVEEEAAARPTMREVVHMLTNPPKSVANLIAF cri4_maize Putative receptor protein kinase CRINKLY4 CR4 protein protein maize Zea mays (Maize) Maize MDHVPALVLAGCCFLALLPGWACGLGSMSSIAVSYGEDGPVFCGLNSDGSHLVACFGADASVLYGAPPNIPFLGLTAGDGFVCGLLLDTRQPYCWGSNSYVKSGVPQPMVEGARYSELSAGDNHLCALRAAQDGGRGSSAATSLIDCWGYNMTATHAVDEAVSTVSAGSVFNCGLFARNRTVFCWGDETVSGVVGLAPRDLHFQSIGAGGYHVCGVLENAQVFCWGRSLEMQQVVPSSAIGDGDVNIVPMDAMSTVVGGRFHACGIRSLDHQVACWGFTLHNSTSPPKGLKMYALVAGDYFTCGVPAETSLMPRCWGNSGPLALPMAVPPGICVPTACSHGYYEYVNHGEVGSIKVCKPANSRLCLPCSTGCPEGLYESSPCNATADRVCQFDCLKCVTDECLSFCLSQKRTKSRKLMAFQMRIFVAEIVFAVVLVLSVSVTTCLYVRHKLRHCQCSNRELRLAKSTAYSFRKDNMKIQPDMEDLKIRRAQEFSYEELEQATGGFSEDSQVGKGSFSCVFKGILRDGTVVAVKRAIKASDVKKSSKEFHNELDLLSRLNHAHLLNLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDPNLKKRLNWARRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSILGPADSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDIFAILDPVLSPPSDLEALKKIASVACKCVRMRGKDRPSMDKVTTALEHALALLMGSPCIEQPILPTEVVLGSSRMHKVSQMSSNHSCSENELADGEDQGIGYRAPSWITFPSVTSSQRRKSSASEADIVGRRATDGRNVGSSIGDGLRSLEEEIAPASPQENLYLQHNF kpro_maize Putative receptor protein kinase ZmPK1 PK1 protein protein maize Zea mays (Maize) Maize MPRPLAALLSTACILSFFIALFPRAASSRDILPLGSSLVVESYESSTLQSSDGTFSSGFYEVYTHAFTFSVWYSKTEAAAANNKTIVWSANPDRPVHARRSALTLQKDGNMVLTDYDGAAVWRADGNNFTGVQRARLLDTGNLVIEDSGGNTVWQSFDSPTDTFLPTQLITAATRLVPTTQSRSPGNYIFRFSDLSVLSLIYHVPQVSDIYWPDPDQNLYQDGRNQYNSTRLGMLTDSGVLASSDFADGQALVASDVGPGVKRRLTLDPDGNLRLYSMNDSDGSWSVSMVAMTQPCNIHGLCGPNGICHYSPTPTCSCPPGYATRNPGNWTEGCMAIVNTTCDRYDKRSMRFVRLPNTDFWGSDQQHLLSVSLRTCRDICISDCTCKGFQYQEGTGSCYPKAYLFSGRTYPTSDVRTIYLKLPTGVSVSNALIPRSDVFDSVPRRLDCDRMNKSIREPFPDVHKTGGGESKWFYFYGFIAAFFVVEVSFISFAWFFVLKRELRPSELWASEKGYKAMTSNFRRYSYRELVKATRKFKVELGRGESGTVYKGVLEDDRHVAVKKLENVRQGKEVFQAELSVIGRINHMNLVRIWGFCSEGSHRLLVSEYVENGSLANILFSEGGNILLDWEGRFNIALGVAKGLAYLHHECLEWVIHCDVKPENILLDQAFEPKITDFGLVKLLNRGGSTQNVSHVRGTLGYIAPEWVSSLPITAKVDVYSYGVVLLELLTGTRVSELVGGTDEVHSMLRKLVRMLSAKLEGEEQSWIDGYLDSKLNRPVNYVQARTLIKLAVSCLEEDRSKRPTMEHAVQTLLSADD tmk1_arath Receptor protein kinase TMK1 TMK1 BARK1-like kinase 1 BLK1 Transmembrane kinase 1 F15E12.4 At1g66150 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKKRRTFLLFSFTFLLLLSLSKADSDGDLSAMLSLKKSLNPPSSFGWSDPDPCKWTHIVCTGTKRVTRIQIGHSGLQGTLSPDLRNLSELERLELQWNNISGPVPSLSGLASLQVLMLSNNNFDSIPSDVFQGLTSLQSVEIDNNPFKSWEIPESLRNASALQNFSANSANVSGSLPGFLGPDEFPGLSILHLAFNNLEGELPMSLAGSQVQSLWLNGQKLTGDITVLQNMTGLKEVWLHSNKFSGPLPDFSGLKELESLSLRDNSFTGPVPASLLSLESLKVVNLTNNHLQGPVPVFKSSVSVDLDKDSNSFCLSSPGECDPRVKSLLLIASSFDYPPRLAESWKGNDPCTNWIGIACSNGNITVISLEKMELTGTISPEFGAIKSLQRIILGINNLTGMIPQELTTLPNLKTLDVSSNKLFGKVPGFRSNVVVNTNGNPDIGKDKSSLSSPGSSSPSGGSGSGINGDKDRRGMKSSTFIGIIVGSVLGGLLSIFLIGLLVFCWYKKRQKRFSGSESSNAVVVHPRHSGSDNESVKITVAGSSVSVGGISDTYTLPGTSEVGDNIQMVEAGNMLISIQVLRSVTNNFSSDNILGSGGFGVVYKGELHDGTKIAVKRMENGVIAGKGFAEFKSEIAVLTKVRHRHLVTLLGYCLDGNEKLLVYEYMPQGTLSRHLFEWSEEGLKPLLWKQRLTLALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMELITGRKSLDESQPEESIHLVSWFKRMYINKEASFKKAIDTTIDLDEETLASVHTVAELAGHCCAREPYQRPDMGHAVNILSSLVELWKPSDQNPEDIYGIDLDMSLPQALKKWQAYEGRSDLESSTSSLLPSLDNTQMSIPTRPYGFAESFTSVDGR o49973_maize Protein-serine/threonine phosphatase KAPP 542351 ZEAMMB73_Zm00001d019169 protein protein maize Zea mays (Maize) Maize MAVPPLLLVAVAVAALSILVLVVFAFRRCRRRRQRHPLQAAAVAPTPVAVQDEDIDRPLLSENQSDHSRQNISFLGSSVGEPSKIQTNRSNTSPRSHAIADTGRIYPAECCVTQGETHVINVENDTSEEFQLGSTLRRTPPPKWPTPDQKHRRRVSGDDNHNGSVPLKDNTYHSRLDLEVIAGPSHGISCSRQSSRPSMLPITLGRVPPSDLVLKDSEVSGKHAQINWNGKTLKWELVDMGSLNGTFLNSQAVHHPSAGSRHWGEPAELAHGDIITLGTSSKLSVQILLQNQRVPAGVGMASDPMVARRSGKKLPMEDISFCQCPLQGVEHFGLFGIFDGHGGDGAAKAVSKILPEHLGYILSHPETKERVQSYSDASDVLRYAFTLTEDTIDHQYEGCTGTALLIWFDQNKDCFAQCANLGDSACVMSVNGKTIDMTEDHRVTSATERARIARTGQPLRDGEARLSGLNLARMFGDKFLKEQDPRFSSEPYVSQAVRITKACTAFAVIASDGLWDVISTKRAVQLVVEGKERRSSGDATSAAARVASRVLDEARSLRTKDNTSVIFVDFDVLRRDPCISPVD o49974_maize Receptor-like serine/threonine-protein kinase KIK1 protein protein maize Zea mays (Maize) Maize MVSSPRLLFLLLAGASLCCVAAQKTDTLRQGESLSGAATLVSSPEGVFEAGFFAPDPKQPSRQYLGIWYHSISPRTVVWVANRVAPATSASPSLTLTVTGDLRVLDGTAANGTADAPLLWSSNTTSRAGPRGGYSAVLQDTGSLEVRSEDGVLWDSFWHPTDTILSGMRITLQAPGRGPKERMLFTSWASETDPSPGRYALGLDPGNSGQAYIWKDGNVTYWRSGQWNGVNFIGIPWRPLYRSGFTPAIDPVLGNYYTYTATNTSLQRFVVLPNGTDICYMVRKSSQDWELVWYQPSNECEYYATCGPNAKCTASQDGKAKCTCLKGFHPKLQEQWNAGNWSQGCIRSPPLGCETNQSGDGFLPMGNIKWPDFSYWVSTVGDEPGCRTVCLNNCSCGAYVYTATTGCLAWGNELIDMHELQTGAYTLNLKLPASELRGHHPIWKIATIISAIVLFVLAACLLLWWKHGRNIKDAVHGSWRSRHSSTQSQQNSAMLDISQSIRFDDDVEDGKSHELKVYSLDRIRTATSNFSDSNKLGEGGFGPVYMGTLPGGEEVAVKRLCRNSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIPREEKILVYEYMPNKSLDAFLFNPEKQRLLDWKKRFDIIEGIARGLLYLHRDSRLRVVHRDLKASNILLDADMKPKISDFGMARMFGGDQNQFNTNRVVGTFGYMSPEYAMEGIFSVKSDVYGFGVLILEIITGKRAVSFHCHEDSLNIAGYAWRQWNEDNAAELIDPVIRASCSVRQVLRCIHIALLCVQDHADERPDIPTVILMLSNDSSSLPNPRPPTLMLRGREIESSKSSEKDRSHSIGTVTMTQLHGR p2c70_arath Protein phosphatase 2C 70 KAPP Kinase-associated protein phosphatase Protein ROOT ATTENUATED GROWTH 1 RAG1 F7K24.30 T24G5.3 At5g19280 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAMIGMNIIGLFMVLMLLLISLIILFACKPWRYFSRFRSSSRFSSTFKVGDLQRPLISDDGNLIQGQTSEVTREYDLEGACYQNDGLLHSSLTEGRFYKQRLPSSSPHFSQGESFVLEVISEPSDNALVGQTLKLPAEKGSLAEVQTYDWQNNRNENLQYNLEKDRLINLSPRLVEDQRSWLFLEVIAGPAIGLQHAVNSTSSSKLPVKLGRVSPSDLALKDSEVSGKHAQITWNSTKFKWELVDMGSLNGTLVNSHSISHPDLGSRKWGNPVELASDDIITLGTTTKVYVRISSQNEFQIPFKIGVASDPMAMRRGGRKLPMEDVCHYKWPLPGANKFGLFCVCDGHGGSGAAQSAIKIIPEVLANILSDSLRKEKVLSKRDASDVLRDMFAKTEARLEEHQYEGCTATVLLVWKDNEENFFAQCANLGDSACVIHLGGRYIQMTEDHRVVSLSERKRFQEAGLALRDGETRLFGINLARMLGDKFPKQQDSRFSAEPYISEPLRIDQSSKDVFAVLASDGLWDVVSPKKAVQLVLQMRDKERGRESSAEKIANGLLNEARAMRTKDNTSIIYLDFDTSL crk10_arath Cysteine-rich receptor-like protein kinase 10 CRK10 RLK4 Receptor-like protein kinase 4 F21P8.70 At4g23180 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRRNTDQESPIMSYYSSFFFLFLFSFLTSFRVSAQDPTYVYHTCQNTANYTSNSTYNNNLKTLLASLSSRNASYSTGFQNATVGQAPDRVTGLFNCRGDVSTEVCRRCVSFAVNDTLTRCPNQKEATLYYDECVLRYSNQNILSTLITTGGVILVNTRNVTSNQLDLLSDLVLPTLNQAATVALNSSKKFGTRKNNFTALQSFYGLVQCTPDLTRQDCSRCLQLVINQIPTDRIGARIINPSCTSRYEIYAFYTESAVPPPPPPPSISTPPVSAPPRSGKDGNSKVLVIAIVVPIIVAVLLFIAGYCFLTRRARKSYYTPSAFAGDDITTADSLQLDYRTIQTATDDFVESNKIGQGGFGEVYKGTLSDGTEVAVKRLSKSSGQGEVEFKNEVVLVAKLQHRNLVRLLGFCLDGEERVLVYEYVPNKSLDYFLFDPAKKGQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGMARIFGLDQTEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLVLEIISGKKNSSFYQTDGAHDLVSYAWGLWSNGRPLELVDPAIVENCQRNEVVRCVHIGLLCVQEDPAERPTLSTIVLMLTSNTVTLPVPRQPGLFFQSRIGKDPLDTDTTSKSLLGSVDDASITDIHPR crk6_arath Cysteine-rich receptor-like protein kinase 6 CRK6 RLK5 Receptor-like protein kinase 5 F7H19.330 F21P8.30 At4g23140 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSLISFNFLFLFSFLTSSFTASAQDPFYLNHYCPNTTTYSSNSTYSTNLRTLLSSLSSRNASYSTGFQNATAGKAPDRVTGLFLCRGDVSPEVCRNCVAFSVNQTLNLCPKVREAVFYYEQCILRYSHKNILSTAITNEGEFILSNTNTISPNQKQIDGFTSFVSSTMSEAAGKAANSSRKLYTVNTELTAYQNLYGLLQCTPDLTRADCLSCLQSSINGMALSRIGARLYWPSCTARYELYPFYNESAIETPPLPPPPPPPPPRESLVSTPPISSSSLPGKSGNSTVLVVAVVVLAVLLFIALVGYCFLAKKKKKTFDTASASEVGDDMATADSLQLDYRTIQTATNDFAESNKIGRGGFGEVYKGTFSNGKEVAVKRLSKNSRQGEAEFKTEVVVVAKLQHRNLVRLLGFSLQGEERILVYEYMPNKSLDCLLFDPTKQIQLDWMQRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADINPKIADFGMARIFGLDQTQDNTSRIVGTYGYMAPEYAMHGQFSMKSDVYSFGVLVLEIISGRKNSSFGESDGAQDLLTHAWRLWTNKKALDLVDPLIAENCQNSEVVRCIHIGLLCVQEDPAKRPAISTVFMMLTSNTVTLPVPRQPGFFIQCRAVKDPLDSDQSTTTKSFPASIDDESITDLYPR q43393_brana Receptor-like serine/threonine-protein kinase protein protein brana Brassica napus (Rape) MKGVRNIYHHSYTSFLLLFLVMILIHPALSIYINTLSSTESLTISSNRTLVSPGDVFELGFFETNSRWYLGMWYKKLPFRTYVWVANRDNPLSNSIGTLKISGNNLVILGHSNKSVWSTNLTRGIDRSTVVAELLANGNFVMRDSNNNDASQFLWQSFDYPTDTLLPEMKLGNDLKTGLNRFLTSWRSSDDPSSGEFLYELETGRLPEFYLSKGIFPAYRSGPWNGIRFSGIPDDQKLSYLVYNFTENSEEVVYTFRMTNNSIYSKLTVSLSGYFERQTWNASLGMWNVSWSLPLPSQCDTYRRCGPYAYCDVSTSPICNCIQGFNPSNVQQWDQRSWSGGCIRRTRLSCSGDGFTRMENMELPETTMAIVDRSIGVKECKKRCLSDCNCTAFANADVQNGGTGCIIWAGELEDIRNYAADGQDLYVRLAAADLVKRRNANGQIISLTVGVSVLLLLIMFCLWKRKQKRANANATSIANRQRNQNLPMNGMVLSSKREFLEEKKIEELELPLIELETVVKATENFSNCNKLGQGGFGIVYKGRLLDGQEIAVKRLSKTSVQGTDEFMNEVTLIARLQHINLVQIIGCCIEADEKMLVYEYLENLSLDSYLFGKTRRSKLNWKERFDIINGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMTPKISDFGMARIFARDETEANTVKVVGTYGYMSPEYAMHEIFSEKSDVFSFGVIVLEIVSGKKNSYNLNYKNNLLSYAWSQWEEGRALEIIDPVIVDSLPSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSVVWMLGSEAKEIPQPKQPGHCIGRSPYDLDPSSSSQCDDDESWTVNQYTCSLVDAR hppd_arath 4-hydroxyphenylpyruvate dioxygenase HPD 4-hydroxyphenylpyruvic acid oxidase PDS1 F12K11.9 At1g06570 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGHQNAAVSENQNHDDGAASSPGFKLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLLTSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKSEFLPGFERVEDASSFPLDYGIRRLDHAVGNVPELGPALTYVAGFTGFHQFAEFTADDVGTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFRTLREMRKRSSIGGFDFMPSPPPTYYQNLKKRVGDVLSDDQIKECEELGILVDRDDQGTLLQIFTKPLGDRPTIFIEIIQRVGCMMKDEEGKAYQSGGCGGFGKGNFSELFKSIEEYEKTLEAKQLVG iron iron small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) hpd_maize_protein 4-hydroxyphenylpyruvate dioxygenase from Zea mays protein protein maize Zea mays (Maize) Maize An amino acid sequence which is not represented in UniProt q5mp56_maize BA1 bHLH67 542186 protein protein maize Zea mays (Maize) Maize MDPYHYQTMYDPRGFPIIHPQPYLQHPVAGALGDSRVRGGGSGARRRPGAKLSTDPQSVAARERRHRISDRFRVLRSLVPGGSKMDTVSMLEQAIHYVKFLKTQISLHQAALMQHEEGCHAELAAYSAVAVVGDNEVTLASHGRTGACDEMMQLQVAAEEALSYGVDAHQPYGLDPRQLSGGHELPPLPASCIFLEEPADACYSVCDLDDGDTGLPGSY a6mw92_maize 100125650 ZEAMMB73_Zm00001d031068 bif2 protein protein maize Zea mays (Maize) Maize MDAAVRVPPALGNKTVTEVTPPPPPPAGEERLSDADTTASSTAAPNSSLSSASSAASLPRCSSLSRLSFDCSPSAALSSSSAAAAAAAASSPAPAPARPHRAGDAAWAAIRAASASAAAPLGPRDFRLLRRVGGGDVGTVYLCRLRAPPAPAPVCCLYAMKVVDRRVAAAKKKLEHAAAERRILRALDHPFLPTLFADFDAAPHFSCVVTEFCPGGDLHSLRHRMPNRRFPLPSARFYAAEVLLALEYLHMMGIVYRDLKPENVLIRADGHIMLTDFDLSLQCTSTPSLEPCAAPEAAAASCFPDHLFRRRRARLRRAASARRPPTTLVAEPVEARSCSFVGTHEYVAPEVARGGPHGAAVDWWALGVFLYELLHGRTPFAGADNEATLRNIARRPLSFPAAGAGDADARDLIARLLAKDPRHRLGSRRGAADVKAHPFFRGLNFALLRSSRPPVVPAASRSPLHRSQSCSAARTRASKPKPPPDTRFDLF xrcc1_human DNA repair protein XRCC1 XRCC1 X-ray repair cross-complementing protein 1 protein protein human Homo sapiens Human MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQESPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRPKLPAPTRTPATAPVPARAQGAVTGKPRGEGTEPRRPRAGPEELGKILQGVVVVLSGFQNPFRSELRDKALELGAKYRPDWTRDSTHLICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSRRYLMAGPGSSSEEDEASHSGGSGDEAPKLPQKQPQTKTKPTQAAGPSSPQKPPTPEETKAASPVLQEDIDIEGVQSEGQDNGAEDSGDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLPVPELPDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDNMSDRVQFVITAQEWDPSFEEALMDNPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA csk2a_maize Casein kinase II subunit alpha ACK2 CK II CK2-alpha protein protein maize Zea mays (Maize) Maize MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENSRTRA 14337_arath 14-3-3-like protein GF14 nu GRF7 At3g02520 F16B3.15 General regulatory factor 7 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSREENVYLAKLAEQAERYEEMVEFMEKVAKTVDTDELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNDDHVSIIKDYRGKIETELSKICDGILNLLDSHLVPTASLAESKVFYLKMKGDYHRYLAEFKTGAERKEAAESTLVAYKSAQDIALADLAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLGEESYKDSTLIMQLLRDNLTLWNSDINDEAGGDEIKEASKHEPEEGKPAETGQ 14332_arath 14-3-3-like protein GF14 omega GRF2 GF14 At1g78300 F3F9.16 General regulatory factor 2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASGREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNDDHVTAIREYRSKIETELSGICDGILKLLDSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLAAYKSAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDAADEIKEAAAPKPTEEQQ 14331_arath 14-3-3-like protein GF14 chi General regulatory factor 1 At4g09000 GRF1 F23J3.30 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATPGASSARDEFVYMAKLAEQAERYEEMVEFMEKVAKAVDKDELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNDDHVSLIRDYRSKIETELSDICDGILKLLDTILVPAAASGDSKVFYLKMKGDYHRYLAEFKSGQERKDAAEHTLTAYKAAQDIANSELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDDVADDIKEAAPAAAKPADEQQS tf2b_human Transcription initiation factor IIB GTF2B TF2B TFIIB General transcription factor TFIIB S300-II protein protein human Homo sapiens Human MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL 14331_maize 14-3-3-like protein GF14-6 GRF1 protein protein maize Zea mays (Maize) Maize MASAELSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEEGRGNEDRVTLIKDYRGKIETELTKICDGILKLLETHLVPSSTAPESKVFYLKMKGDYYRYLAEFKTGAERKDAAENTMVAYKAAQDIALAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDISEDPAEEIREAPKRDSSEGQ 14334_arath 14-3-3-like protein GF14 phi General regulatory factor 4 GRF4 At1g35160 T32G9.30 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAPPASSSAREEFVYLAKLAEQAERYEEMVEFMEKVAEAVDKDELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNDDHVTTIRDYRSKIESELSKICDGILKLLDTRLVPASANGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLTAYKAAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQDESPEEIKEAAAPKPAEEQKEI 14333_arath 14-3-3-like protein GF14 psi Protein RARE COLD INDUCIBLE 1A RCI1A MXI10.21 At5g38480 GRF3 General regulatory factor 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTREENVYMAKLAEQAERYEEMVEFMEKVAKTVDVEELSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESKGNEDHVAIIKDYRGKIESELSKICDGILNVLEAHLIPSASPAESKVFYLKMKGDYHRYLAEFKAGAERKEAAESTLVAYKSASDIATAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDDAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMTDEAGDEIKEASKPDGAE fer1_maize Ferredoxin-1, chloroplastic FDX1 Ferredoxin I pFD1 protein protein maize Zea mays (Maize) Maize MATVLGSPRAPAFFFSSSSLRAAPAPTAVALPAAKVGIMGRSASSRRRLRAQATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELTGA q9slp6_maize Ferredoxin--NADP reductase, chloroplastic ZEAMMB73_Zm00001d045575 L-FNRI protein protein maize Zea mays (Maize) Maize MATVMAAAVSSFPSSSAVVAKASPASPCAAPHFRPRAVRAAIRAQASAVEAPATAKAKKESKKQEEGVVTNLYKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGKIPYREGQSIGVIADGVDKNGKPHKVRLYSIASSAIGDFGDSKTVSLCVKRLIYTNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSLAEKDGIDWFDYKKQLKRGDQWNVEVY bzp25_arath Basic leucine zipper 25 BZIP25 BZO2H4 Basic leucine zipper OPAQUE 2 homolog 4 T14E10.190 At3g54620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MHIVFSVDDLTESFWPVPAPAPSPGSSSTPSPTQNVADGMTRSQSEWAFHRLINELSGSDSSPTTNTIERSPPPVQSLSRLEETVDETEDVVEIQKPQNHRRLPVDDQGKNRNRAPSSDPVDSSAPVVVDPNQYHAILKSKLELACAAVARRVGTVKPEDSSASASNQKQAQGSIVAQTSPGASSVRFSPTTSTQKKPDVPARQTSISSRDDSDDDDLDGDADNGDPTDVKRARRMLSNRESARRSRRRKQEQMNEFDTQVGQLRAEHSTLINRLSDMNHKYDAAAVDNRILRADIETLRTKVKMAEETVKRVTGVNPLHWSRPNMGIPFSNTPSASSSIPPNSNHILKPANSSTNTSAGLAQNQRVETANFLPEQVNREGMQNPFAPDSNLYETLPHWNHKH bzp10_arath Basic leucine zipper 10 BZIP10 BZO2H1 Basic leucine zipper OPAQUE 2 homolog 1 T10P11.9 At4g02640 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNSIFSIDDFSDPFWETPPIPLNPDSSKPVTADEVSQSQPEWTFEMFLEEISSSAVSSEPLGNNNNAIVGVSSAQSLPSVSGQNDFEDDSRFRDRDSGNLDCAAPMTTKTVIVDSDDYRRVLKNKLETECATVVSLRVGSVKPEDSTSSPETQLQPVQSSPLTQGELGVTSSLPAEVKKTGVSMKQVTSGSSREYSDDEDLDEENETTGSLKPEDVKKSRRMLSNRESARRSRRRKQEQTSDLETQVNDLKGEHSSLLKQLSNMNHKYDEAAVGNRILKADIETLRAKVKMAEETVKRVTGMNPMLLGRSSGHNNNNRMPITGNNRMDSSSIIPAYQPHSNLNHMSNQNIGIPTILPPRLGNNFAAPPSQTSSPLQRIRNGQNHHVTPSANPYGWNTEPQNDSAWPKKCVD op2_maize Regulatory protein opaque-2 O2 protein protein maize Zea mays (Maize) Maize MEHVISMEEILGPFWELLPPPAPEPEREQPPVTGIVVGSVIDVAAAGHGDGDMMDQQHATEWTFERLLEEEALTTSTPPPVVVVPNSCCSGALNADRPPVMEEAVTMAPAAVSSAVVGDPMEYNAILRRKLEEDLEAFKMWRADSSVVTSDQRSQGSNNHTGGSSIRNNPVQNKLMNGEDPINNNHAQTAGLGVRLATSSSSRDPSPSDEDMDGEVEILGFKMPTEERVRKKESNRESARRSRYRKAAHLKELEDQVAQLKAENSCLLRRIAALNQKYNDANVDNRVLRADMETLRAKVKMGEDSLKRVIEMSSSVPSSMPISAPTPSSDAPVPPPPIRDSIVGYFSATAADDDASVGNGFLRLQAHQEPASMVVGGTLSATEMNRVAAATHCAGAMELIQTAMGSMPPTSASGSTPPPQIMSCWVQMGPYTWTCIRHCGFRDRWEHFICRRR at2s1-arath-dna At2S1 promoter dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress TTCTTACACGTGAACTC cru3-arath-dna CRU3 promoter dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress TAATCCTACGTGGCTCA lbd6_maize LOB domain-containing protein 6 LBD6 AS2 IG1 Protein ASYMMETRIC LEAVES 2 Protein indeterminate gametophyte 1 ZmIG1 protein protein maize Zea mays (Maize) Maize MASSVPAPSGSVITVASSSSSAAAAAVCGTGSPCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPFQREDAVNSLAYEADMRLRDPVYGCVGVISILQHNLRQLQQDLARAKYELSKYQAAAAASASTAPTGPQAMAEFIGNAMPNGAHNFINIGHSAALGSLGGSASVFGQEQFGNAQMLSRSYDGGEPIARLGINGGGYEFGYSTAMGGSGAVSGLGTLGISPFLKSGTAGGDEKPNGGQ LOB domain, Zn finger and leucine zipper-like motif. hira_maize Protein HIRA Histone regulator protein protein protein maize Zea mays (Maize) Maize MILEKPSWIRHEGLQIFSIDIQTGGLRFATGGGDQKVRIWSMESVHKDNTNNDSKQRLLATLRDHFGSVNCVRWAKHGRYLASGSDDQVILIHERKAGSGTSEFGSGEPPDAENWKVIMTWRGHTADVVDLSWSPDDSTLASGSLDNTIHIWNMNNGICTAVLRGHTSLVKGVTWDPIGSFIASQSDDKTVMIWRTSDWSLAHKTEGHWTKSLGSTFFRRLAWSPCCHFITTTHGFQKPRHSAPVLERGEWAATFDFLGHNAPIVVVKFNNSTFRKNFSSDQDPKAAPVGWANGASKTPTKEQQPYNVIAIGSQDRTITVWTTASARPLFVARHFFSQSVVDLSWSPDGYSLFACSLDGSAANFHFEVKELGHRLSDSEMDEWKRNRYGDVGGRQSNLAESPAQLLLEQASAKQSAGEKVTSIVEQGKAPPKVSAGVPNPGLVVLSLEVPEVSHEDSKKTAGPTADDVKKGNQLSSPVKQREYRRPDGRKRIIPEAVGFASNQDNIPNHSQNHPVNFSSLDQRMNGTKPSYGSNSNSNNCGVKDRTSVTARANITESLVIQKASAGAGNDGRLSIEHTRSMAPSSLTPCSALSIHVINKNGNEDALPVCLEARPVERGAGDMIGVGALSTKETEIKCIKGTKTLWSDRISGKVTVLAGNANFWAVGCEDGFLQVYTRCGVRAMPAMMMGSAAVFIDCDDSWKLLLVTGRGLMYIWNLYDRACILHDSLASLVASPDESSAKDAGTVKVISATFSRCGSPLVALASRHAFLYDMSLKCWLRIADDCFPASNFASSFSFPQGGELGKLQIDIGKFMARKPIWSRVTDDGLQTRAHLENQLASSLALKSAQEYRQCLLSYVRFLAREADESRLREVCESFLGPPMGKVGSASPTDPKNLAWDPDVLGMKKHKLLKEDILPSMASNRKVQRLLNEFMDLLLEYETDVTLIPQPGTEGNGNGNDKVMTS rik_maize Protein RIK Rough sheath 2-interacting KH domain protein protein protein maize Zea mays (Maize) Maize MTEDRAHKVADEPAASGRQSPERKKRKWDQPAEDLVSAAVTAAAVSGMPVMNFGALPGVVLPGVTAYGAATLPSVVPVPYSLPPHIAPSVLQNAAAAAQKLSQAKIPDEVIAREIVINDADPSVRYKLTKRQTQEEIQKCTNTVIITRGKYHPPNLLPDGEKPLYLHISAGSQLKDTAERIKAVDRAASMIEEILKQGTTSESISVPFSSSTGQAVRPFSASVFLGFDADPSLNITARIRGPNDQYINHIMKETGVTVVLRGKDSENLGSCHSEASQQPLHLYLTSMHLKNLEAAKVLAENLLDTVAAEFGASRISSSKVYGAVPPPQQLLAGVDTSGTKSDVHYIVGPNVLSGATHSFASTGVIAPVVAPAVTVQSGAPTYSGVPLPSNMAYPIPPANGGAFYSGYGDIYPQATPLQQLAFTLKHASSSATQAVPVTSTPTSMATKGNSILDAEMDKRSRRKFQELPVSKGPATESQNSQQGSKFVKTGLDSSGNIGSSSIAPPKKVHPGSNGMLPQEEADMPSHLSISTKMLPPPLKSMLPLPPRSMPPPPPKSMPPPPPKFPSDEFLSRNENKFFPLKEPTAPPRSFDAISVLPSERRPREPKEEKNKRHTCV wrky1_maize Protein WRKY1 WRKY DNA-binding protein 1 protein protein maize Zea mays (Maize) Maize MEGMEEANRTAVESCHRVLALLSNPHGQLVPSKELVAATGEAVAKFGSLTAKLSNSNGDGLLQGHARVRKVKKPLHIFDSNLFLESSAVAAAAAPAKTPSPSPILGLQLFPRYHQFEGSSSKDPVRIPTQFPKRLLLEKPTAGMEGSTSQSPPIVQMVQPVSVAPPAGTPTPALPPAHLHFIQQQQSYQRFQLMQQMKIQSEMMKRSNLGDQGGSLSGGGGGGRKGVNLKFDSSNCTASSSRSFLSSLSMEGSLASLDGSRTSRPFQLLSGSQTASTPELGLVQRRRCAGREDGTGRCATGSRCHCSKKRKLRIRRSIKVPAISNKVADIPADEFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERCVDDPSMLIVTYEGDHNHNRVLAQPA rs2_maize Protein rough sheath 2 Protein PHANTASTICA ZmPHAN RS2 protein protein maize Zea mays (Maize) Maize MKERQRWRPEEDAVLRAYVRQYGPREWHLVSQRMNVALDRDAKSCLERWKNYLRPGIKKGSLTEEEQRLVIRLQAKHGNKWKKIAAEVPGRTAKRLGKWWEVFKEKQQRELRDSRRPPPEPSPDERGRYEWLLENFAEKLVGERPQQAAAAPSPLLMAAPVLPPWLSSNAGPAAAAAAAVAHPPPRPPSPSVTLSLASAAVAPGPPAPAPWMPDRAAADAAPYGFPSPSQHGGAAPPGMAVVDGQALAELAECCRELEEGRRAWAAHRREAAWRLKRVEQQLEMEREMRRREVWEEFEAKMRTMRLEQAAAAERVERDHREKVAELRRDAQVKEEKMAEQWAAKHARVAKFVEQMGGCSRSWSSATDMNC lbd36_arath LOB domain-containing protein 36 ASYMMETRIC LEAVES 2-like protein 1 LBD36 ASL1 At5g66870 MUD21.13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSSSPCAACKFLRRKCTQECVFAPYFPPDQPQKFAFVHKVFGASNVAKLLNELASNQREDAVNSLFYEAEARLRDPVYGCVGLISILQHRLKQVNHDLENAKKELATYVGPQAMLPILQPHFMSLPPQPQRPSSSSASVLTQHHHNLLPMMAIPTGQLYHQQQQQIFEAQQLAAVAREQQNEMFRAYGGGGGSSSPHHQNQAQAEILRFNNGFDSVPAGSVTVTGFNQLSSGGTAVTGMSLGGNFVDSPSTNNNYHTDQQLHHHHQPQQHHEAQLFIPSQSSQPLPLQTQETQTQTQPNSESEEGRRNVIG rik_arath Protein RIK RIK Rough sheath 2-interacting KH domain protein MUO10.13 At3g29390 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTEDNDEARVPLSDSSTTNDASRTRQRRKRKWDKPAEQLVAAGVAFPQLLPLGNTMNVPSMSPLLQTLSVPLAVPKVNQPKIQDEVIIAREIVINDAEASLRHRLTKRSTQEDIQRSTGAVVITRGKYRPPNAPPDGEKPLYLHISAAAQLQLKETTERILAVDRAAAMIEEMMKQKSISQIGSVGLQTVKMLSTCVYLGFEADPSSNVAARIRGPNDQYINHIMNETGATVVLRGRGSGSLENQHGDEAQLPLHLLLSGSNPKSIDDAKRLAENLMDTISVEFGASRVSSSKVYGAVPPPQQLISGAPGSDQENQNLISTYGLMTSIPITAPPYAVSSFPVTPATSLYPQFPVMQSLGISNGGPSQPVAGGTSYSGYAGIYPQATPLQQVAQVLKQSISPVISTVPPTMLTATSLSIPSDNASNEMERRPPRKRKFQELPADCKVPEKDKQQSELAMTGDVTPSANRVRSPPSPRSVMPPPPPKTIAPPPSKTMSPPSSKSMLPPPPRSKTMSPLSSKSMLPPPPRFTLTTQRSRLQDNHISVKKPNPVPDTLIKLMEYGDDEDDDDDPDEPLTTRS K-homology RNA binding domain as1_arath Transcription factor AS1 Protein ASYMMETRIC LEAVES 1 Myb-related protein 91 Protein PHANTASTICA AS1 MYB91 PHAN At2g37630 F13M22.13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKERQRWSGEEDALLRAYVRQFGPREWHLVSERMNKPLNRDAKSCLERWKNYLKPGIKKGSLTEEEQRLVIRLQEKHGNKWKKIAAEVPGRTAKRLGKWWEVFKEKQQREEKESNKRVEPIDESKYDRILESFAEKLVKERSNVVPAAAAAATVVMANSNGGFLHSEQQVQPPNPVIPPWLATSNNGNNVVARPPSVTLTLSPSTVAAAAPQPPIPWLQQQQPERAENGPGGLVLGSMMPSCSGSSESVFLSELVECCRELEEGHRAWADHKKEAAWRLRRLELQLESEKTCRQREKMEEIEAKMKALREEQKNAMEKIEGEYREQLVGLRRDAEAKDQKLADQWTSRHIRLTKFLEQQMGCRLDRP o04724_maize R protein protein maize Zea mays (Maize) Maize MALSASRVQQAEELLQRPAERQLMRSQLAAAARASTGATPSSGPFQTLNQ gl1_arath Trichome differentiation protein GL1 GL1 MYB0 K16N12.17 At3g27920 Protein GLABROUS 1 Protein GLABRA 1 R2R3-MYB transcription factor GL1 Myb-related protein 0 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRIRRRDEKENQEYKKGLWTVEEDNILMDYVLNHGTGQWNRIVRKTGLKRCGKSCRLRWMNYLSPNVNKGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLVGDYSSAVKTTGEDDDSPPSLFITAATPSSCHHQQENIYENIAKSFNGVVSASYEDKPKQELAQKDVLMATTNDPSHYYGNNALWVHDDDFELSSLVMMNFASGDVEYCL to204_arath Mitochondrial import receptor subunit TOM20-4 TOM20-4 Translocase of outer membrane 20 kDa subunit 4 MMG1.2 At5g40930 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDMQNENERLMVFEHARKVAEATYVKNPLDAENLTRWAGALLELSQFQTEPKQMILEAILKLGEALVIDPKKHDALWLIGNAHLSFGFLSSDQTEASDNFEKASQFFQLAVEEQPESELYRKSLTLASKAPELHTGGTAGPSSNSAKTMKQKKTSEFKYDVFGWVILASYVVAWISFANSQTPVSRQ oe64m_arath Outer envelope protein 64, mitochondrial At5g09420 OM64 TOC64-V Mitochondrial outer membrane protein 64 Translocon at the outer membrane of chloroplasts 64-V T5E8.220 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNTLSLIQSNASNPKVWVVIGVTVAGIVILAETRKRRIRALREEDFGAFLDRFELLPFPPPPPPAAKQSLSGLTFSISDAFDVKDYITGFGCPQWKKTHEAAEKTAVVVTTLLKNGATCVGKTIMDELGFGIIGENKHYGTPINPLMPDNVPGGCSSGSAVSVGAELVDFSLGIDTTGGVRVPAAFCGILGFRPSQGTVSSVGVLPNSQSLETVGWFASDPSVLCQVGHALLNLSAVTHRRQRSLIFADDLFELSDIPKQKSVQVVRKAIENLSGYKTPKHVNVGQYVASNVPSLAEFCEQSGKSQNSASTLRALSSVMLAIQRHEFKTNHEEWWQTCKSFLGPRFSNDVVTALKSKNESIKSLYRVKNEMRATIQSLLKEDGILVIPTVADPPPRLNTKRNKSLNEFLDRTYALSCIASMSGCCQVTIPLGEHGDRPISVSLLTYYGGDKFLLDTTLDVYASLQDQAKLASNLAPVSDTNGNMEASEVMKEKGNAAYKGKQWNKAVNFYTEAIKLNGANATYYCNRAAAFLELCCFQQAEQDCTKAMLIDKKNVKAYLRRGTARESLVRYKEAAADFRHALVLEPQNKTAKVAEKRLRKHI to401_arath Mitochondrial import receptor subunit TOM40-1 TOM40-1 Translocase of outer membrane 40 kDa subunit homolog 1 MZE19.5 At3g20000 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADLLPPLTAAQVDAKTKVDEKVDYSNLPSPVPYEELHREALMSLKSDNFEGLRFDFTRALNQKFSLSHSVMMGPTEVPAQSPETTIKIPTAHYEFGANYYDPKLLLIGRVMTDGRLNARLKADLTDKLVVKANALITNEEHMSQAMFNFDYMGSDYRAQLQLGQSALIGATYIQSVTNHLSLGGEIFWAGVPRKSGIGYAARYETDKMVASGQVASTGAVVMNYVQKISDKVSLATDFMYNYFSRDVTASVGYDYMLRQARVRGKIDSNGVASALLEERLSMGLNFLLSAELDHKKKDYKFGFGLTVG o80413_maize 103627788 ZEAMMB73_Zm00001d018183 protein protein maize Zea mays (Maize) Maize MALSDRSRESLLPSFLYASSARSFAATGAAARLPVSSPAPATAGAGGGVPFSIQAPKEKIEMYSPAFYAACTAGGIASCGLTHMAVTPLDLVKCNMQIDPAKYKSISSGFGILLKEQGARGFFRGWVPTLLGYSAQGACKFGFYEFFKKYYSDIAGPEYAQKYKTLIYLAGSASAEVIADVALCPFEAVKVRVQTQPGFARGLSDGLPKFVRSEGVLGLYKGIVPLWGRQIPYTMMKFASFETIVELIYKHAVPVPKSECSKTTQLGISFAGGYIAGVFCAIVSHPADNLVSFLNNAKGATVGDAVKKLGLWGLFTRGLPLRIVMIGTLTGAQWGIYDAFKVMVGLPTTGGVTPAPAAEAELKASA gshrp_arath Glutathione reductase, chloroplastic At3g54660 EMB2360 Protein EMBRYO DEFECTIVE 2360 T5N23_20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASTPKLTSTISSSSPSLQFLCKKLPIAIHLPSSSSSSFLSLPKTLTSLYSLRPRIALLSNHRYYHSRRFSVCASTDNGAESDRHYDFDLFTIGAGSGGVRASRFATSFGASAAVCELPFSTISSDTAGGVGGTCVLRGCVPKKLLVYASKYSHEFEDSHGFGWKYETEPSHDWTTLIANKNAELQRLTGIYKNILSKANVKLIEGRGKVIDPHTVDVDGKIYTTRNILIAVGGRPFIPDIPGKEFAIDSDAALDLPSKPKKIAIVGGGYIALEFAGIFNGLNCEVHVFIRQKKVLRGFDEDVRDFVGEQMSLRGIEFHTEESPEAIIKAGDGSFSLKTSKGTVEGFSHVMFATGRKPNTKNLGLENVGVKMAKNGAIEVDEYSQTSVPSIWAVGDVTDRINLTPVALMEGGALAKTLFQNEPTKPDYRAVPCAVFSQPPIGTVGLTEEQAIEQYGDVDVYTSNFRPLKATLSGLPDRVFMKLIVCANTNKVLGVHMCGEDSPEIIQGFGVAVKAGLTKADFDATVGVHPTAAEEFVTMRAPTRKFRKDSSEGKASPEAKTAAGV to202_arath Mitochondrial import receptor subunit TOM20-2 TOM20-2 Translocase of outer membrane 20 kDa subunit 2 F17L21.18 At1g27390 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEFSTADFERLIMFEHARKNSEAQYKNDPLDSENLLKWGGALLELSQFQPIPEAKLMLNDAISKLEEALTINPGKHQALWCIANAYTAHAFYVHDPEEAKEHFDKATEYFQRAENEDPGNDTYRKSLDSSLKAPELHMQFMNQGMGQQILGGGGGGGGGGMASSNVSQSSKKKKRNTEFTYDVCGWIILACGIVAWVGMAKSLGPPPPAR to203_arath Mitochondrial import receptor subunit TOM20-3 TOM20-3 Translocase of outer membrane 20 kDa subunit 3 MOJ10.15 At3g27080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTETEFDRILLFEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQFHSISDAKQMIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFLTPDETEAKHNFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQLHAEAYKQGLGSQPMGRVEAPAPPSSKAVKNKKSSDAKYDAMGWVILAIGVVAWISFAKANVPVSPPR mtx_arath Mitochondrial outer membrane import complex protein METAXIN MTX1 T20K24.9 At2g19080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGDQETNVYTLVARKPSFDLPTACPNCLPAYIYLKLAQLPFELAFNSTFPDSDELPYFESDTYVAYNNEDGGVIEKLKKDGIVNLDSQLQSLSDYLSLKALIVSWLEEALTYEIWVGTEGISTSKIYYSDLPWVISKVLFYKQTYLAKNRLGITKENAEQREKQIYKRASEAYEALSTRLGEQKFLFEDRPSSLDAFLLSHILFIIQALPVTSVLRCKLLEHSNLVRYAEKLKSEFLEASSSSPSPPLHSFPSSFPRKSSKPKSKPKVEKTEEEKKFKKRARFFLAAQFLAVVIYVSVMGGGSSDELEYEDEDD q7dm06_soybn protein protein soybn Glycine max (Soybean) Glycine hispida IYGCQILLQKEHAIPVRHFAKESAPPALKGDEMLKNIFVEVKNKFETAIGILKKEKITIDPEDP aox1_soybn Ubiquinol oxidase 1, mitochondrial AOX1 Alternative oxidase 1 protein protein soybn Glycine max (Soybean) Glycine hispida MMMMMSRSGANRVANTAMFVAKGLSGEVGGLRALYGGGVRSESTLALSEKEKIEKKVGLSSAGGNKEEKVIVSYWGIQPSKITKKDGTEWKWNCFSPWGTYKADLSIDLEKHMPPTTFLDKMAFWTVKVLRYPTDVFFQRRYGCRAMMLETVAAVPGMVAGMLLHCKSLRRFEHSGGWFKALLEEAENERMHLMTFMEVAKPKWYERALVITVQGVFFNAYFLGYLLSPKFAHRMFGYLEEEAIHSYTEFLKELDKGNIENVPAPAIAIDYWQLPPGSTLRDVVMVVRADEAHHRDVNHFASDIHYQGRELREAAAPIGYH kapp-kik-5 771262 n/a 771265 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 771266 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5C kapp-tmk1 771262 n/a 771267 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 771266 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5C kapp-q43393 771262 n/a 771268 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 771266 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5C kapp-crk6 771262 n/a 771266 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 771269 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5C The authors state that the region of the CRK6 protein used was 649 to 999 amino acids in length. However both UniProt and TAIR records show that the CRK10 protein is 647 amino acids and 670 amino acids respectively. Note the TAIR record differs a several regions in its sequence to the UniProt record. kapp-crk10 771262 n/a 771270 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 771266 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5C The authors state that the region of CRK10 used was 427 to 797 amino acids however both UniProt and TAIR records show the CRK10 protein to be 658 amino acids and 670 amino acids in length respectively. Note the TAIR entry has an N-terminal amino acid sequence ( MRRNTDQESPI) which the UniProt record lacks. kapp-tmk1-1 771262 n/a 771267 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 771271 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind range range range range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5B The authors do not provide the amino acid coordinates of the KI region of the Arabidopsis KAPP protein used in this study. The KI domain is thought to be equivilent to the FHA (IPR000253) domain recorded in the UniProt entry for this protein. This range has been used to represent the KI region and entered as 'fuzzy coordinates', (see IntAct annotation manual availaible on the IntAct website), to indicate the fact that the exact coordinates are unknown. kapp-q43393-1 771262 n/a 771268 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 771271 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind range range range range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false The authors do not provide the amino acid coordinates of the KI region of the Arabidopsis KAPP protein used in this study. The KI domain is thought to be equivilent to the FHA (IPR000253) domain recorded in the UniProt entry for this protein. This range has been used to represent the KI region and entered as 'fuzzy coordinates', (see IntAct annotation manual availaible on the IntAct website), to indicate the fact that the exact coordinates are unknown. Figure 5B kapp-crk6-2 771262 n/a 771269 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 771271 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind range range range range false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false The authors do not provide the amino acid coordinates of the KI region of the Arabidopsis KAPP protein used in this study. The KI domain is thought to be equivilent to the FHA (IPR000253) domain recorded in the UniProt entry for this protein. This range has been used to represent the KI region and entered as 'fuzzy coordinates', (see IntAct annotation manual availaible on the IntAct website), to indicate the fact that the exact coordinates are unknown. Figure 5B The authors state that the region of the CRK6 protein used was 649 to 999 amino acids in length. However both UniProt and TAIR records show that the CRK10 protein is 647 amino acids and 670 amino acids respectively. Note the TAIR record differs a several regions in its sequence to the UniProt record. kapp-crk10-1 771262 n/a 771270 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 771271 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind range range range range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5B The authors state that the region of CRK10 used was 427 to 797 amino acids however both UniProt and TAIR records show the CRK10 protein to be 658 amino acids and 670 amino acids in length respectively. Note the TAIR entry has an N-terminal amino acid sequence ( MRRNTDQESPI) which the UniProt record lacks. The authors do not provide the amino acid coordinates of the KI region of the Arabidopsis KAPP protein used in this study. The KI domain is thought to be equivilent to the FHA (IPR000253) domain recorded in the UniProt entry for this protein. This range has been used to represent the KI region and entered as 'fuzzy coordinates', (see IntAct annotation manual availaible on the IntAct website), to indicate the fact that the exact coordinates are unknown. kapp-kik1-3 771262 n/a 771271 unspecified role unspecified role prey prey region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 771269 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false The authors do not provide the amino acid coordinates of the KI region of the Arabidopsis KAPP protein used in this study. The KI domain is thought to be equivilent to the FHA (IPR000253) domain recorded in the UniProt entry for this protein. This range has been used to represent the KI region and entered as 'fuzzy coordinates', (see IntAct annotation manual availaible on the IntAct website), to indicate the fact that the exact coordinates are unknown. Figure 5B The authors state that the region of the CRK6 protein used was 649 to 999 amino acids in length. However both UniProt and TAIR records show that the CRK10 protein is 647 amino acids and 670 amino acids respectively. Note the TAIR record differs a several regions in its sequence to the UniProt record. kik-4 771263 n/a 771265 putative self putative self putative self putative self region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O49974:p.Lys558Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false true false Figure 3 Figure 5b O49974 was autophosphorylated (on a serine and/or threonine residue(s)). The authors concluded "these results establish that KIK1 is a serine/threonine protein kinase". tmk1 771263 n/a 771267 putative self putative self putative self putative self region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false true false Figure 5b autophosphorylation crk6 771263 n/a 771269 putative self putative self putative self putative self region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false true false Figure 5b autophosphorylation The authors state that a region of 649-999 amino acids were used in this assay. However the TAIR or UniProt record show that the CRK6 protein is 680 and 674 amino acids respectively. Note the TAIR record shows an insertion of the amino acids (FVVDSS) between amino acid 517 and 518 in the UniProt record. The protein RLK5 was renamed according to the Naming convention from Chen et al 2003 (PMID 14756307). crk10 771263 n/a 771270 putative self putative self putative self putative self region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false true false Figure 5b autophosphorylation The authors state that a region of 427-797 amino acids were used in this assay. However the TAIR or UniProt record show that the CRK6 protein is 669 and 658 amino acids respectively. Note the TAIR record shows an insertion of the amino acids (MRRNTDQESPI) at the amino terminus of the UniProt record. The protein RLK4 was renamed according to the Naming convention from Chen et al 2003 (PMID 14756307). q43393 771263 n/a 771268 putative self putative self putative self putative self c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false true false Figure 5b autophosphorylation pk1-2 771263 n/a 771272 putative self putative self putative self putative self region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false true false Figure 5b autophosphorylation cr4 771263 n/a 771273 putative self putative self putative self putative self region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false true false Figure 5b autophosphorylation kapp-kapp 771264 n/a 771266 unspecified role unspecified role prey prey n/a 771271 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 1 The authors state that "we screened a maize leaf cDNA library at reduced stringency using the Arabidopsis KI domain as a hybridization probe", however the amino acid coordinates of this region are not provided. The KI domain is thought to be equivilent to the FHA (IPR000253) domain recorded in the UniProt entry for this protein. This range has been used to represent the KI region and entered as 'fuzzy coordinates', (see IntAct annotation manual availaible on the IntAct website), to indicate the fact that the exact coordinates are unknown. kapp-kik-3 771264 n/a 771265 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 771266 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 2 hpd-1 Homodimerisation of HPD demonstrated by X-ray crystallography 607568 N/A 607569 unspecified role unspecified role neutral component neutral component gly-ser-his tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) Stoichiometry: 2.0 direct interaction direct interaction false false false 3.00A working 23.7%, free 31.2% hpd-2 Homodimerisation of HPD demonstrated by X-ray crystallography 607568 N/A 607570 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) Stoichiometry: 2.0 N/A 607571 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false 2.00A working 27.5%, free 32.4% tf2b-grf1 806845 n/a 806848 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 806849 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 1A tf2b-grf4 806845 n/a 806848 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 806850 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 1B Figure 2A tf2b-grf3 806845 n/a 806848 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 806851 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 1B tf2b-grf7 806845 n/a 806852 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 806848 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 1B tf2b-grf2 806845 n/a 806853 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 806848 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 1B tf2b-grf1-1 806845 n/a 806854 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 806848 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 1B at3g54620-dna AT3G54620 binds the AtS1 promoter region 695505 N/A 695507 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) N/A 695508 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false Figure 4B Mutation of the ACGT sequence to AAGG abolished interaction. at3g54620-dna-1 AT3G54620 binds the CRU3 promoter region 695505 N/A 695507 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) N/A 695509 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false Figure 4B Mutation of the ACGT sequence to AAGG abolished interaction. at4g02640-dna-2 AT4G02640 binds the CRU3 promoter region 695505 N/A 695510 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) N/A 695509 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false Figure 4B Mutation of the ACGT sequence to AAGG abolished interaction. at4g02640-dna-3 AT4G02640 binds the AtS1 promoter region 695505 N/A 695510 unspecified role unspecified role neutral component neutral component N/A 695508 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false Figure 4B and Figure 4C Mutation of the ACGT sequence to AAGG abolished interaction. The presence of the ABI3 (Q01593) protein stimulated protein binding to DNA It is not clear from the text if recombinant or in vitro synthesised proteins were used o2-dna-4 Opaque2 binds the AtS1 promoter region 695505 N/A 695508 unspecified role unspecified role neutral component neutral component N/A 695511 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false Figure 4C The presence of the ABI3 (Q01593) protein increased protein binding to DNA It is not clear from the text if recombinant or in vitro synthesised proteins were used. gl1-r GL1 protein binds maize R protein in vitro 766227 n/a 766228 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro n/a 766229 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Figure 9C The authors state "since the myb domain of GL1 could not efficiently precipitate R it indicates that something in the carboxy terminus of GL1 is also necessary for a stable interaction and that the myc epitope itself is not the source of the interaction". kapp-kik1-1 771029 n/a 771265 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O49974:p.Lys558Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 771271 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 3B kapp-cvl1 771029 n/a 771034 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 771271 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 3B kapp-kik1-2 771030 n/a 771265 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 771271 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 4 Temp=25C kapp-cvl1-1 771030 n/a 771271 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 771034 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 4 Temp=25C kapp-kik1 771031 n/a 771265 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O49974:p.Lys558Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n/a 771271 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P46014:p.Gly211Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P46014:p.Ser226Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P46014:p.His229Leu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P46014:p.Asn250Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 2D Figure 2E metaxin-aox1-2 720226 n/a 720229 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 720230 unspecified role unspecified role bait bait physical association physical association false false false Figure 7C metaxin-fad-1 720226 n/a 720230 unspecified role unspecified role bait bait n/a 720231 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 7C metaxin-tom40-1 720226 n/a 720232 unspecified role unspecified role prey prey n/a 720230 unspecified role unspecified role bait bait physical association physical association false false false Figure 7C metaxin-pic-1 720226 n/a 720233 unspecified role unspecified role prey prey n/a 720230 unspecified role unspecified role bait bait physical association physical association false false false Figure 7C tom20_4-aox1-3 720226 n/a 720229 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 720234 unspecified role unspecified role bait bait physical association physical association false false false Figure 7C tom20_4-fad-2 720226 n/a 720231 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 720234 unspecified role unspecified role bait bait physical association physical association false false false Figure 7C tom20_4-tom40-2 720226 n/a 720234 unspecified role unspecified role bait bait n/a 720232 unspecified role unspecified role prey prey physical association physical association false false false Figure 7C tom20_4-pic-2 720226 n/a 720233 unspecified role unspecified role prey prey n/a 720234 unspecified role unspecified role bait bait physical association physical association false false false Figure 7C mto64-aox1-3 720226 n/a 720235 unspecified role unspecified role bait bait n/a 720229 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 7C mto64-fad-2 720226 n/a 720231 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 720235 unspecified role unspecified role bait bait physical association physical association false false false Figure 7C mto64-pic-2 720226 n/a 720233 unspecified role unspecified role prey prey n/a 720235 unspecified role unspecified role bait bait physical association physical association false false false Figure 7C mto64-tom40-2 720226 n/a 720235 unspecified role unspecified role bait bait n/a 720232 unspecified role unspecified role prey prey physical association physical association false false false Figure 7C tom20_2-aox1-4 720226 n/a 720236 unspecified role unspecified role bait bait n/a 720229 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 7C tom20_3-aox1 720226 n/a 720237 unspecified role unspecified role bait bait n/a 720229 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 7C tom20_2-fad-3 720226 n/a 720231 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 720236 unspecified role unspecified role bait bait physical association physical association false false false Figure 7C tom20_3-fad 720226 n/a 720231 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 720237 unspecified role unspecified role bait bait physical association physical association false false false Figure 7C tom20_2-pic-3 720226 n/a 720233 unspecified role unspecified role prey prey n/a 720236 unspecified role unspecified role bait bait physical association physical association false false false Figure 7C tom20_3-pic-4 720226 n/a 720233 unspecified role unspecified role prey prey n/a 720237 unspecified role unspecified role bait bait physical association physical association false false false Figure 7C tom20_2-tom40-3 720226 n/a 720236 unspecified role unspecified role bait bait n/a 720232 unspecified role unspecified role prey prey physical association physical association false false false Figure 7C tom20_3-tom40 720226 n/a 720237 unspecified role unspecified role bait bait n/a 720232 unspecified role unspecified role prey prey physical association physical association false false false Figure 7C mto64-gr 720226 n/a 720235 unspecified role unspecified role bait bait n/a 720238 unspecified role unspecified role prey prey physical association physical association false false false Figure 7C The authors made the following observation " Arabidopsis GR is a dual-targeted protein, although the plastid receptor for this protein has not yet been determined. It contains the consensus phosphorylation motif in the targeting signal that has been reported to increase targeting ability to chloroplast. Thus, it is possible that it can interact with At TOC64-III, although the color was weak compared with the color development with mitochondrial precursor proteins and mitochondrial outer membrane components". metaxin-aox1-1 720227 n/a 720230 unspecified role unspecified role bait bait in vitro In vitro n/a 720229 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Figure 7A metaxin-fad 720227 n/a 720231 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro n/a 720230 unspecified role unspecified role bait bait in vitro In vitro direct interaction direct interaction false false false Figure 7A metaxin-pic 720227 n/a 720233 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 720230 unspecified role unspecified role bait bait in vitro In vitro direct interaction direct interaction false false false Figure 7A metaxin-tom40 720227 n/a 720230 unspecified role unspecified role bait bait in vitro In vitro n/a 720232 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Figure 7A mto64-fad-1 720227 n/a 720231 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro n/a 720235 unspecified role unspecified role bait bait in vitro In vitro direct interaction direct interaction false false false Figure 7A mto64-aox1-2 720227 n/a 720229 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro n/a 720235 unspecified role unspecified role bait bait in vitro In vitro direct interaction direct interaction false false false Figure 7A mto64-pic-1 720227 n/a 720233 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 720235 unspecified role unspecified role bait bait in vitro In vitro direct interaction direct interaction false false false Figure 7A mto64-tom40-1 720227 n/a 720232 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 720235 unspecified role unspecified role bait bait in vitro In vitro direct interaction direct interaction false false false Figure 7A tom20_4-pic-1 720227 n/a 720233 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 720234 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 7A tom20_4-tom40-1 720227 n/a 720232 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 720234 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 7A tom20_4-aox1-2 720227 n/a 720234 unspecified role unspecified role bait bait n/a 720229 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false Figure 7A tom20_4-fad-1 720227 n/a 720231 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro n/a 720234 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 7A fdx1-l_fnri-1 Crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase 512313 N/A 512314 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 512315 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false , dimeric, multimeric, monomeric working 76.800%, free 70.300% 2.59A ack2-xrcc1 1445358 n/a 1445361 enzyme enzyme unspecified role unspecified role 562-rosetta ii de3 Escherichia coli rosetta ii de3 rosetta ii de3 n/a 1445360 enzyme target enzyme target substrate substrate unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 562-rosetta ii de3 Escherichia coli rosetta ii de3 rosetta ii de3 phosphorylation phosphorylation reaction phosphorylation false false false Fig. 1c phosphorylation of XRCC1 on ser518, thr519 and thr523 rs2-as2-1 Interaction between rough sheath 2 and asymmetric leaves 2 from maize by Y2H 253941 N/A 253943 unspecified role unspecified role prey prey N/A 253944 unspecified role unspecified role bait bait physical association physical association false false false rs2-wrky1-1 Interaction between rough sheath 2 and WRKY1 from maize by Y2H 253941 N/A 253944 unspecified role unspecified role bait bait N/A 253945 unspecified role unspecified role prey prey physical association physical association false false false rs2-rik-1 Interaction between rough sheath 2 and RIK from maize by Y2H 253941 N/A 253944 unspecified role unspecified role bait bait N/A 253946 unspecified role unspecified role prey prey physical association physical association false false false rs2-hira-1 Interaction between rough sheath 2 and HIRA from maize by Y2H 253941 N/A 253944 unspecified role unspecified role bait bait N/A 253947 unspecified role unspecified role prey prey physical association physical association false false false as1-rik-1-1 Interaction between Arabidopsis AS1 and RIK by Y2H 253941 N/A 253948 unspecified role unspecified role bait bait N/A 253949 unspecified role unspecified role prey prey physical association physical association false false false as1-as2-1 Interaction between Arabidopsis AS1 and AS2 by Y2H 253941 N/A 253948 unspecified role unspecified role bait bait N/A 253950 unspecified role unspecified role prey prey physical association physical association false false false rs2-as2-2 Interaction between rough sheath 2 and asymmetric leaves 2 from maize by GST pulldown 253942 N/A 253943 unspecified role unspecified role prey prey in vitro In vitro N/A 253944 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false rs2-wrky1-2 Interaction between rough sheath 2 and WRKY1 from maize by GST pulldown 253942 N/A 253945 unspecified role unspecified role prey prey in vitro In vitro N/A 253944 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false rs2-rik-2 Interaction between rough sheath 2 and RIK from maize by GST pulldown 253942 N/A 253946 unspecified role unspecified role prey prey in vitro In vitro N/A 253944 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false rs2-hira-2 Interaction between rough sheath 2 and HIRA from maize by GST pulldown 253942 N/A 253944 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 253947 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false as1-hira-1 Interaction between Arabidopsis AS1 and HIRA from maize by GST pulldown 253942 N/A 253947 unspecified role unspecified role prey prey in vitro In vitro N/A 253948 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false r-wer Interaction between Maize R protein (TTG1 homologue) and Arabidopsis WER protein 672672 N/A 672673 unspecified role unspecified role prey prey N/A 672674 unspecified role unspecified role bait bait physical association physical association false false false 6 The R protein was identified from references provided in the text bif2 Bif2 autophosphorylation 757045 N/A 757050 putative self putative self putative self putative self region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false A6MW92:p.Lys161Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false A6MW92:p.Asp258Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false true false Figure 3 Bif2 was shown to autophosphorylate. bif2-ba1-3 Bif2 phosphorylates BA1 757045 N/A 757051 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 757050 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false A6MW92:p.Lys161Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false A6MW92:p.Asp258Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false Figure 3 Phosphorylation of BA1 (Q5MP56). bif2-ba1 Bif2 interacts with BA1 757046 N/A 757051 unspecified role unspecified role prey prey N/A 757050 unspecified role unspecified role bait bait physical association physical association false false false bif2-ba1-1 Bif2 interacts with BA1 757047 N/A 757050 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 757051 unspecified role unspecified role prey prey physical association physical association false false false Figure 2a bif2-ba1-2 Bif2 interacts with BA1 757048 N/A 757051 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 757050 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 2b bif2-ba1-4 Bif2 colocalises with BA1 757049 N/A 757050 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 757051 unspecified role unspecified role neutral component neutral component region mCherry red fluorescent tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Figure 5 Proteins colocalised to the nucleus.