DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ price-2009-1 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Price AJ., Marzetta F., Lammers M., Ylinen LM., Schaller T., Wilson SJ., Towers GJ., James LC. DIP original experiment: DIP-133309X Nature structural & molecular biology 2009 IMEx Active site remodeling switches HIV specificity of antiretroviral TRIMCyp. Price AJ., Marzetta F., Lammers M., Ylinen LM., Schaller T., Wilson SJ., Towers GJ., James LC. Only protein-protein interactions imex curation price-2009-2 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Price AJ., Marzetta F., Lammers M., Ylinen LM., Schaller T., Wilson SJ., Towers GJ., James LC. DIP original experiment: DIP-133310X Nature structural & molecular biology 2009 IMEx Active site remodeling switches HIV specificity of antiretroviral TRIMCyp. Price AJ., Marzetta F., Lammers M., Ylinen LM., Schaller T., Wilson SJ., Towers GJ., James LC. Only protein-protein interactions imex curation q76929_9hiv2 gag protein protein 9hiv2 Human immunodeficiency virus 2 ANELDRFGLAESLLESKEGCQRILTVLDPLVPTGSENLKSLFNTVCVAWCIHAEEKVKDTEGAKQIVQRHLVAETGTAEKMPSTSRPTAPPSGEGGNFPVQHVGGNYTHIPLSPRTLNAWVKLVEEKKFGAEVVPGFQALSEGCTPYDINQMLNCVGDHQAAMQIIREIINEEAAEWDVQHPIPGPLPAGQLREPRGSDIAGTTSTVDEQIQWMFRPQNPVPVGNIYRRWIQIGLQKCVRMYNPTNILDIKQGPKEPFQS ppia_macmu Peptidyl-prolyl cis-trans isomerase A PPIA CYPA Cyclophilin A Cyclosporin A-binding protein Rotamase A protein protein macmu Macaca mulatta (Rhesus macaque) Rhesus macaque MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE q72497_9hiv1 Gag polyprotein gag protein protein 9hiv1 Human immunodeficiency virus 1 MGARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNYPIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVLAEAMSQVTNPATIMIQKGNFRNQRKTVKCFNCGKEGHIAKNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSHKGRPGNFLQSRPEPTAPPEESFRFGEETTTPSQRQEPIDKELYPLASLRSLFGSDPSSQ gag-ppia-9 3196162 N/A 3196164 unspecified role unspecified role unspecified role unspecified role Region 99-242 Region 99-242 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3196165 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false gag-ppia-10 3196163 N/A 3196166 unspecified role unspecified role unspecified role unspecified role Region 133-278 Region 133-278 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3196165 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ berthoux-2005-1 Disruption of human TRIM5alpha antiviral activity by nonhuman primate orthologues. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Berthoux L., Sebastian S., Sayah DM., Luban J. The mutants lacking the SPRY domain could not interact with HIV-1 GAG protein. Protein TRIMStop, a truncated version of TRIMCyp lacking the CypA domain was used. 4A JL45@columbia.edu J. Virol. (0022-538X) 2005 mische-2005-1 Retroviral restriction factor TRIM5alpha is a trimer. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Mische CC., Javanbakht H., Song B., Diaz-Griffero F., Stremlau M., Strack B., Si Z., Sodroski J. HEK-293T cells transiently expressing the TRIM5-alpha variants were lysed and cross-linked with different concentrations (mM) of glutaraldehyde and ethylene glycolbis(succinimidylsuccinate). This was followed by anti-tag CoIP. 2 joseph_sodroski@dfci.harvard.edu J. Virol. (0022-538X) 2005 mische-2005-2 Retroviral restriction factor TRIM5alpha is a trimer. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Mische CC., Javanbakht H., Song B., Diaz-Griffero F., Stremlau M., Strack B., Si Z., Sodroski J. HEK-293T cells transiently expressing the TRIM5-alpha variants were lysed and cross-linked with different concentrations (mM) of glutaraldehyde and ethylene glycolbis(succinimidylsuccinate). This was followed by anti-tag CoIP. 2 joseph_sodroski@dfci.harvard.edu J. Virol. (0022-538X) 2005 bonaventura-2014-1 L-DOPA-treatment in primates disrupts the expression of A(2A) adenosine-CB(1) cannabinoid-D(2) dopamine receptor heteromers in the caudate nucleus. macfa-brain_striatum M. fascicularis striatum brain_striatum Brain striatum, Neostratum. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Bonaventura J., Rico A.J., Moreno E., Sierra S., Sánchez M., Luquin N., Farré D., Müller C.E., Martínez-Pinilla E., Cortés A., Mallol J., Armentero M.T., Pinna A., Canela E.I., Lluís C., McCormick P.J., Lanciego J.L., Casadó V., Franco R. Affinomics - Interactions curated for the Affinomics consortium. Radioligand studies have not been included as the specificities of ligand(s) binding is not known. rfranco123@gmail.com,vcasado@ub.edu Neuropharmacology (0028-3908) 2014 imex curation Only protein-protein interactions kumar-2012-1 The MUC1 extracellular domain subunit is found in nuclear speckles and associates with spliceosomes. macmu-cytotrophoblast Macaca mulatta cytotrophoblast Cytotrophoblast confocal microscopy confocal microscopy immunostaining immunostaining Kumar P., Lindberg L., Thirkill T.L., Ji J.W., Martsching L., Douglas G.C. Affinomics - Interactions curated for the Affinomics consortium. Colocalizations of MUC1 with lamin B and Matrin 3 were not curated because there is not further evidence for the interaction fo these proteins in the publication. gcdouglas@ucdavis.edu PLoS ONE 2012 Only protein-protein interactions imex curation q0pf16-2 Tripartite motif-containing protein 5 TRIM5 TRIM5alpha RING-type E3 ubiquitin transferase TRIM5 protein protein macmu Macaca mulatta (Rhesus macaque) Rhesus macaque MASGILLNVKEEVTCPICLELLTEPLSLHCGHSFCQACITANHKKSMLYKEGERSCPVCRISYQPENIQPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDKTNVSADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISELEHRLQGSMMDLLQGVDGIIKRIENMTLKKPKTFHKNQRRVFRAPDLKGMLDMFRELTDARRYWGKEKSHYHQPPCGLSLLLSLSFRILYSLLGLVF No experimental confirmation available. trim5_chlae Tripartite motif-containing protein 5 TRIM5 TRIM5alpha RING-type E3 ubiquitin transferase TRIM5 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey MASGILLNVKEEVTCPICLELLTEPLSLPCGHSFCQACITANHKESMLYKEEERSCPVCRISYQPENIQPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDKTNVSADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISDLEHRLQGSMMELLQGVDGIIKRVENMTLKKPKTFHKNQRRVFRAPDLKGMLDMFRELTDVRRYWVDVTLAPNNISHAVIAEDKRQVSYQNPQIMYQAPGSSFGSLTNFNYCTGVLGSQSITSRKLTNFNYCTGVLGSQSITSGKHYWEVDVSKKSAWILGVCAGFQPDATYNIEQNENYQPKYGYWVIGLQEGDKYSVFQDSSSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSPSS q2y080_aotaz Peptidyl-prolyl cis-trans isomerase protein protein aotaz Aotus azarai (Southern owl monkey) Aotus azarae MVNPTVFFDIAVDGEPLGRVSFELFADKLPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTPHNGTGGKSIYGVKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNVVEAMERFGCRYGKTSKKITIADCGQL q9c035-1 Tripartite motif-containing protein 5 TRIM5 RNF88 RING finger protein 88 RING-type E3 ubiquitin transferase TRIM5 protein protein human Homo sapiens Human MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRISYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQTQSLRELISDLEHRLQGSVMELLQGVDGVIKRTENVTLKKPETFPKNQRRVFRAPDLKGMLEVFRELTDVRRYWVDVTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGSQSITSGKHYWEVDVSKKTAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDSSFHTPSVPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPRKCGVPMTLCSPSS trim5_macmu Tripartite motif-containing protein 5 TRIM5 TRIM5alpha RING-type E3 ubiquitin transferase TRIM5 protein protein macmu Macaca mulatta (Rhesus macaque) Rhesus macaque MASGILLNVKEEVTCPICLELLTEPLSLHCGHSFCQACITANHKKSMLYKEGERSCPVCRISYQPENIQPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDKTNVSADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISELEHRLQGSMMDLLQGVDGIIKRIENMTLKKPKTFHKNQRRVFRAPDLKGMLDMFRELTDARRYWVDVTLAPNNISHAVIAEDKRQVSSRNPQIMYQAPGTLFTFPSLTNFNYCTGVLGSQSITSGKHYWEVDVSKKSAWILGVCAGFQSDAMYNIEQNENYQPKYGYWVIGLQEGVKYSVFQDGSSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSPSS h9elz9_macmu U2 snRNP auxiliary factor large subunit U2AF2 protein protein macmu Macaca mulatta (Rhesus macaque) Rhesus macaque MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRRRSKPLTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVSPPSTINQTPVTLQVPGLMSSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW f6zv85_macmu MUC1 protein protein macmu Macaca mulatta (Rhesus macaque) Rhesus macaque MTPGTQSPFFLLLILTVLTGSGHTNSTPGGEKETSATQRSSMPISTKNAVSMTSRLSSHSPVSGSSTTQGQDVTLALATEPATGSATTLGHNVTSAPDTSAAPGSTGWGIALLVLVCVLVVLAIVYFIALAVCQCRQKNYRQLDIFPARDAYHPMSEYPTYHTHGRYVPAGGTNRSPYEEVSAGNGGSSLSYTNPAVAATSANL f7cyh8_macmu D(2) dopamine receptor DRD2 Dopamine D2 receptor protein protein macmu Macaca mulatta (Rhesus macaque) Rhesus macaque MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRSHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKNHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC g7p3k6_macfa Cannabinoid receptor 1 EGM_13830 protein protein macfa Macaca fascicularis (Crab-eating macaque) Cynomolgus monkey MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL f6x9c0_macmu Adenosine receptor A2 ADORA2A protein protein macmu Macaca mulatta (Rhesus macaque) Rhesus macaque MGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCNHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSTQESQGNTSLPDVELLSHELKGVCPEPPGLDDPLAQGGAGVS trim5-trimcyp 363441 N/A 363444 unspecified role unspecified role bait bait N/A 363445 unspecified role unspecified role prey prey physical association physical association false false false The mutants TRIMStop and hu TRIMStop showed interaction.TRIMStop is a truncated version of TRIMCyp lacking the CypA domain. trim5-trimcyp-1 363441 N/A 363445 unspecified role unspecified role prey prey n/a 363446 unspecified role unspecified role bait bait physical association physical association false false false The mutants TRIMStop and hu TRIMStop showed interaction. Interaction was also observed with huTRIMStop. TRIMStop is a truncated version of TRIMCyp lacking the CypA domain. trimcyp-trimcyp 363441 N/A 363445 unspecified role unspecified role bait bait N/A 363445 unspecified role unspecified role prey prey physical association physical association false false false The mutants TRIMStop and TRIMStop showed interaction.TRIMStop is a truncated version of TRIMCyp lacking the CypA domain. trim5 363418 n/a 363420 unspecified role unspecified role neutral component neutral component c terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false spry motif required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Higher oligomers are observed. Deletions of 1-93 and 1-132 showed the presence of dimers, trimers and higher oligomers. These were more evident under reduced conditions induced by the use of beta-Mercaptoethanol. The TRIM5-alpha isoform was used. trim5-1 363418 N/A 363446 unspecified role unspecified role neutral component neutral component c terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Stoichiometry: 3.0 direct interaction direct interaction false false false Higher oligomers were observed. The TRIM5-alpha isoform was used. trim5-2 363418 N/A 363446 unspecified role unspecified role neutral component neutral component c terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Stoichiometry: 2.0 direct interaction direct interaction false false false The TRIM5-gamma isoform was used. trim5-4 363418 N/A 363422 unspecified role unspecified role neutral component neutral component Stoichiometry: 3.0 direct interaction direct interaction false false false Some dimers and higher oligomers were also observed. trim5-5 363418 N/A 363445 unspecified role unspecified role neutral component neutral component Stoichiometry: 3.0 direct interaction direct interaction false false false Some trimers were observed however the majority were higher oligomer fraction. trim5-3 363419 N/A 363446 unspecified role unspecified role neutral component neutral component c terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Stoichiometry: 3.0 direct interaction direct interaction false false false The TRIM5-alpha isoform was used. Mainly trimers and higher oligomers were observed in the presence of glutaraldehyde while dimers and trimers were observed in the presence of ethylene glycolbis(succinimidylsuccinate). drd2-g7n3f5 1572173 n/a 1572174 unspecified role unspecified role neutral component neutral component n/a 1572175 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 1,4,5 The number of positive cells (receptor heteromers) was significantly reduced in Putamen slices compared with the caudate nucleus. The expression of heteromers was reduced in caudate nucleus slices from l-DOPA treated monkeys as compared with control and monkeys with induced Parkinsons Disease. drd2-g7n3f5-1 1572173 n/a 1572176 unspecified role unspecified role neutral component neutral component n/a 1572174 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 1,4,5 The number of positive cells (receptor heteromers) was significantly reduced in Putamen slices compared with the caudate nucleus. The expression of heteromers was reduced in caudate nucleus slices from l-DOPA treated monkeys as compared with control and monkeys with induced Parkinsons Disease. drd2-g7n3f5-2 1572173 n/a 1572175 unspecified role unspecified role neutral component neutral component n/a 1572176 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 1,4,5 The number of positive cells (receptor heteromers) was significantly reduced in Putamen slices compared with the caudate nucleus. The expression of heteromers was reduced in caudate nucleus slices from l-DOPA treated monkeys as compared with control and monkeys with induced Parkinsons Disease. muc1-u2af2 1434828 n/a 1434831 unspecified role unspecified role neutral component neutral component n/a 1434832 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 5a MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint gampe-2000-1 Asymmetry in the PPARgamma/RXRalpha crystal structure reveals the molecular basis of heterodimerization among nuclear receptors. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Gampe RT., Montana VG., Lambert MH., Miller AB., Bledsoe RK., Milburn MV., Kliewer SA., Willson TM., Xu HE. Virus - Publications including interactions involving viral proteins Mol. Cell (1097-2765) 2000 rxra_human Retinoic acid receptor RXR-alpha RXRA NR2B1 Retinoid X receptor alpha Nuclear receptor subfamily 2 group B member 1 protein protein human Homo sapiens Human MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT pparg_macmu Peroxisome proliferator-activated receptor gamma PPARG NR1C3 Nuclear receptor subfamily 1 group C member 3 protein protein macmu Macaca mulatta (Rhesus macaque) Rhesus macaque MGETLGDSPIDPESDSFTDTLSANISQEITMVDTEMPFWPTNFGISSVDLSVMDDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRTDPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY mint Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the receptor binds to a promoter element in the gene for acyl-CoA oxidase and activates its transcription. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis pparg-rxra 100357 pparg_macmu 100358 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 rxra_human 100359 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false In the xray complex 1fm9, P19793 is chain A and O18924 is chain D Resolution 2.100 mint