DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ farelli-2013-1 ecolx Escherichia coli pull down pull down weight by staining molecular weight estimation by staining weight by staining Farelli JD., Gumbart JC., Akey IV., Hempstead A., Amyot W., Head JF., McKnight CJ., Isberg RR., Akey CW. DIP original experiment: DIP-254627X Structure (London, England : 1993) 2013 IMEx IcmQ in the Type 4b secretion system contains an NAD+ binding domain. Farelli JD., Gumbart JC., Akey IV., Hempstead A., Amyot W., Head JF., McKnight CJ., Isberg RR., Akey CW. Only protein-protein interactions imex curation farelli-2013-2 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom weight by staining molecular weight estimation by staining weight by staining Farelli JD., Gumbart JC., Akey IV., Hempstead A., Amyot W., Head JF., McKnight CJ., Isberg RR., Akey CW. DIP original experiment: DIP-254628X Structure (London, England : 1993) 2013 IMEx IcmQ in the Type 4b secretion system contains an NAD+ binding domain. Farelli JD., Gumbart JC., Akey IV., Hempstead A., Amyot W., Head JF., McKnight CJ., Isberg RR., Akey CW. Only protein-protein interactions imex curation farelli-2013-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Farelli JD., Gumbart JC., Akey IV., Hempstead A., Amyot W., Head JF., McKnight CJ., Isberg RR., Akey CW. DIP original experiment: DIP-254629X Structure (London, England : 1993) 2013 IMEx IcmQ in the Type 4b secretion system contains an NAD+ binding domain. Farelli JD., Gumbart JC., Akey IV., Hempstead A., Amyot W., Head JF., McKnight CJ., Isberg RR., Akey CW. Only protein-protein interactions imex curation q5zyc9_legph icmR lpg0443 protein protein legph Legionella pneumophila subsp. pneumophila MGNNTDDSARNPFGFYTPPRVKEIGEPDVTDATLGSVYSEIISPVKDCILTVAKAVSFNPGGKDNTDAVEVLTELNTKVERAALNQPILTTKTERMFGAAESEKSSEPPSHDERGFKLSS a5ihf0_legpc A5IHF0_LEGPC protein protein legpc legpc This sequence has been withdrawn from Uniprot. icmr-icmq-1 3294643 N/A 3294646 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecolx Escherichia coli N/A 3294647 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false icmq-icmr-4 3294644 N/A 3294646 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3294647 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false icmq-icmr-5 3294645 N/A 3294646 unspecified role unspecified role unspecified role unspecified role Region 28-86 Region 28-86 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3294647 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false