DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ diep-2007-2 laclm Lactococcus lactis subsp. cremoris (strain MG1363) anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Diep DB., Skaugen M., Salehian Z., Holo H., Nes IF. DIP original experiment: DIP-261063X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Common mechanisms of target cell recognition and immunity for class II bacteriocins. Diep DB., Skaugen M., Salehian Z., Holo H., Nes IF. Only protein-protein interactions imex curation lcia_lacll Lactococcin-A immunity protein lciA protein protein lacll Lactococcus lactis subsp. lactis Streptococcus lactis MKKKQIEFENELRSMLATALEKDISQEERNALNIAEKALDNSEYLPKIILNLRKALTPLAINRTLNHDLSELYKFITSSKASNKNLGGGLIMSWGRLF a2rj81_laclm ptnC llmg_0728 protein protein laclm Lactococcus lactis subsp. cremoris (strain MG1363) MEYGVLSVILVILVAFLAGLEGILDQWQFHQPIIACSLIGIVTGHASAGIILGGSLQLIALGWANVGAAVAPDAALASIASSILMVQSNNFDLTHIMGTIVPAAILLATAGLVLTTLVRMLSVVLVHQADRAAENGSYSGVEMWHFIALICQGLRIAIPAGLLLVISPEAIQNALAAIPPVISGGLAVGGGMVVAVGYAMVINLMATREVWPFFFLGFALAPISELTLIATGVLGVVIAIVYLNLQSSGGSGNGTASSSGDPIGDILNDY a2rj80_laclm ptnD llmg_0727 protein protein laclm Lactococcus lactis subsp. cremoris (strain MG1363) MSDKKVTLDKKIRRSVMWRSMFLQGSWNYERMQNGGWAYSLIPALKKLYPSGEEAKEALKRHLEFFNTHPYVAAPIIGVTLALEEERANGADIDDAAIQGVKVGMMGPLAGIGDPVFWFTVRPIVGAIAASLAVGGSIIAPLFFFIVWNAIRIAFLWYTQEFGYKSGSAITKDLGGGLLQTVTKGASILGMFVLGVLIQRWVTTNFNGANAVVSKIPLQKGAYVEFPKGSVSGTQLHEILGQVGNKLSLDPTKVTYLQDNLNQLIPGLAGLLITFLCMWLLKKKVSPIVIIFGLFIVGILGRWAQIM a2rj82_laclm EIIAB-Man EIII-Man Mannose-specific phosphotransferase enzyme IIA component Mannose-specific phosphotransferase enzyme IIB component PTS system mannose-specific EIIA component PTS system mannose-specific EIIAB component PTS system mannose-specific EIIB component llmg_0729 ptnAB protein protein laclm Lactococcus lactis subsp. cremoris (strain MG1363) MSIGIVIASHGEFAAGIKQSGSMIFGEQEKVQVVTFMPSEGPTDLHAKIEAAIATFDAEDEVLVLADLWSGSPFNQASAVMGENPERKIAIITGLNLPMLIQAYTERMMDASAGVDKVVANIMKEAKGGIKVLPEELQPAEETAVAAAPAAVQGAIPEGTVIGDGKIKINLARIDSRLLHGQVATAWTPDSRANRIIVVSDTVSKDELRKKLIEQAAPTGVKANVIPIKKMIEVAKDPRFGDTKALLLFETPQDALATIEGGVPIDTLNVGSMAHSTGKTMLNKVLSMDKDDVATFEKLRDLGVKFDVRKVPADSKSDLFGLIKKANVQ lcia-ptnab-2 3152739 N/A 3152740 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false laclm Lactococcus lactis subsp. cremoris (strain MG1363) N/A 3152744 unspecified role unspecified role prey prey laclm Lactococcus lactis subsp. cremoris (strain MG1363) N/A 3152745 unspecified role unspecified role prey prey laclm Lactococcus lactis subsp. cremoris (strain MG1363) N/A 3152746 unspecified role unspecified role prey prey laclm Lactococcus lactis subsp. cremoris (strain MG1363) association association false false false MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint madoori-2009-1 Structure of the transcriptional regulator LmrR and its mechanism of multidrug recognition. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Madoori PK., Agustiandari H., Driessen AJ., Thunnissen AM. EMBO J. (0261-4189) 2009 2009-03-09 Only protein-protein interactions imex curation rowland-2000-1 Structure of dihydroorotate dehydrogenase B: electron transfer between two flavin groups bridged by an iron-sulphur cluster. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Rowland P., Norager S., Jensen KF., Larsen S. PDBe - Data obtained from the Protein Data Bank Europe Structure (0969-2126) 2000 pyrk_laclm Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit pyrK llmg_1105 Dihydroorotate oxidase B, electron transfer subunit protein protein laclm Lactococcus lactis subsp. cremoris (strain MG1363) MSQLQEMMTVVSQREVAYNIFEMVLKGTLVDEMDLPGQFLHLAVPNGAMLLRRPISISSWDKRAKTCTILYRIGDETTGTYKLSKLESGAKVDVMGPLGNGFPVAEVTSTDKILIIGGGIGVPPLYELAKQLEKTGCQMTILLGFASENVKILENEFSNLKNVTLKIATDDGSYGTKGHVGMLMNEIDFEVDALYTCGAPAMLKAVAKKYDQLERLYISMESRMACGIGACYACVEHDKEDESHALKVCEDGPVFLGKQLSL pyrdb_laclm Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit pyrDB Orotate reductase (NADH) llmg_1106 Dihydroorotate oxidase B protein protein laclm Lactococcus lactis subsp. cremoris (strain MG1363) MTENNRLSVKLPGLDLKNPIIPASGCFGFGEEYAKYYDLNKLGSIMVKATTLHPRFGNPTPRVAETASGMLNAIGLQNPGLEVIMTEKLPWLNENFPELPIIANVAGSEEADYVAVCAKIGDAANVKAIELNISCPNVKHGGQAFGTDPEVAAALVKACKAVSKVPLYVKLSPNVTDIVPIAKAVEAAGADGLTMINTLMGVRFDLKTRQPILANITGGLSGPAIKPVALKLIHQVAQVVDIPIIGMGGVANAQDVLEMYMAGASAVAVGTANFADPFVCPKIIDKLPELMDQYRIESLESLIQEVKEGKK a2ri36_laclm llmg_0323 protein protein laclm Lactococcus lactis subsp. cremoris (strain MG1363) MAEIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDESQGGRRKYYRLTEIGHENMRLAFESWSRVDKIIENLEANKKSEAIK mint a2ri36-a2ri36 800636 a2ri36_laclm lmrR 800637 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified a2ri36_laclm lmrR 800637 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false F1 mint pyrdb-pyrk-1 Crystal structure of lactococcus lactis dihydroorotate dehydrogenase b 99657 N/A 99658 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 99659 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false tetrameric, multimeric working 79.800%, free 74.400% 2.2A pyrdb-pyrk-2 Crystal structure of lactococcus lactis dihydroorotate dehydrogenase b complexed with orotate 99657 N/A 99659 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 99658 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false tetrameric, multimeric working 81.00%, free 75.900% 2.4A pyrdb-pyrk-3 Crystal structure of lactococcus lactis dihydroorotate dehydrogenase b. data collected under cryogenic conditions. 99657 N/A 99658 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 99659 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false tetrameric, multimeric working 80.500%, free 76.300% 2.1A