UniProt UniProt http://www.uniprot.org fan-2010-1 Z proteins of New World arenaviruses bind RIG-I and interfere with type I interferon induction. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fan L., Briese T., Lipkin WI. wil2001@columbia.edu J. Virol. (0022-538X) 2010 Only protein-protein interactions imex curation fan-2010-4 Z proteins of New World arenaviruses bind RIG-I and interfere with type I interferon induction. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Fan L., Briese T., Lipkin WI. wil2001@columbia.edu J. Virol. (0022-538X) 2010 Only protein-protein interactions imex curation fan-2010-2 Z proteins of New World arenaviruses bind RIG-I and interfere with type I interferon induction. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. imaging technique imaging technique microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Fan L., Briese T., Lipkin WI. wil2001@columbia.edu J. Virol. (0022-538X) 2010 Only protein-protein interactions imex curation ddx28_human Probable ATP-dependent RNA helicase DDX28 DDX28 MDDX28 Mitochondrial DEAD box protein 28 protein protein human Homo sapiens Human MALTRPVRLFSLVTRLLLAPRRGLTVRSPDEPLPVVRIPVALQRQLEQRQSRRRNLPRPVLVRPGPLLVSARRPELNQPARLTLGRWERAPLASQGWKSRRARRDHFSIERAQQEAPAVRKLSSKGSFADLGLEPRVLHALQEAAPEVVQPTTVQSSTIPSLLRGRHVVCAAETGSGKTLSYLLPLLQRLLGQPSLDSLPIPAPRGLVLVPSRELAQQVRAVAQPLGRSLGLLVRDLEGGHGMRRIRLQLSRQPSADVLVATPGALWKALKSRLISLEQLSFLVLDEADTLLDESFLELVDYILEKSHIAEGPADLEDPFNPKAQLVLVGATFPEGVGQLLNKVASPDAVTTITSSKLHCIMPHVKQTFLRLKGADKVAELVHILKHRDRAERTGPSGTVLVFCNSSSTVNWLGYILDDHKIQHLRLQGQMPALMRVGIFQSFQKSSRDILLCTDIASRGLDSTGVELVVNYDFPPTLQDYIHRAGRVGRVGSEVPGTVISFVTHPWDVSLVQKIELAARRRRSLPGLASSVKEPLPQAT z_sabvb RING finger protein Z Z Zinc-binding protein protein protein sabvbm Sabia mammarenavirus (isolate Human/Brasil/SPH114202/1990) MGNSKSKSKLSANQYEQQTVNSTKQVAILKRQAEPSLYGRHNCRCCWFANTNLIKCSDHYICLKCLNIMLGKSSFCDICGEELPTSIVVPIEPSAPPPED z_machu RING finger protein Z Z Zinc-binding protein protein protein machu machupo virus MACV MGNCNKPPKRPPNTQTSAAQPSAEFRRTALPSLYGRYNCKCCWFADTNLITCNDHYLCLRCHQTMLRNSELCHICWKPLPTSITVPVEPSAPPP z_gtovv RING finger protein Z Z Zinc-binding protein protein protein gtovv guanarito virus (iso MGNSKSKSNPSSSSESQKGAPTVTEFRRTAIHSLYGRYNCKCCWFADKNLIKCSDHYLCLRCLNVMLKNSDLCNICWEQLPTCITVPEEPSAPPE ddx58_human Antiviral innate immune response receptor RIG-I DEAD box protein 58 Retinoic acid-inducible gene 1 protein DDX58 Probable ATP-dependent RNA helicase DDX58 Retinoic acid-inducible gene I protein RIG-I-like receptor 1 protein protein human Homo sapiens Human MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKFLLELQEEGWFRGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIPTDIISDLSECLINQECEEILQICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERNKFSELWIVEKGIKDVETEDLEDKMETSDIQIFYQEDPECQNLSENSCPPSEVSDTNLYSPFKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELEQVVYKPQKFFRKVESRISDKFKYIIAQLMRDTESLAKRICKDLENLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKALFLYTSHLRKYNDALIISEHARMKDALDYLKDFFSNVRAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK z_junin RING finger protein Z Z Zinc-binding protein protein protein juninm Junin mammarenavirus MGNCNGASKSNQPDSSRVTQPAAEFRRVAHSSLYGRYNCKCCWFADTNLITCNDHYLCLRCHQVMLRNSDLCNICWKPLPTTITVPVEPTAPPP ddx58-z-jun-1 1021517 n/a 1021521 unspecified role unspecified role prey prey n/a 1021522 unspecified role unspecified role bait bait n-terminal region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2A ddx58-z-jun-2 1021517 n/a 1021521 unspecified role unspecified role prey prey n/a 1021522 unspecified role unspecified role bait bait c-terminal region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 2A ddx58-z-gtov-1 1021517 n/a 1021522 unspecified role unspecified role bait bait n-terminal region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1021523 unspecified role unspecified role prey prey physical association physical association false false false fig. 2a ddx58-z-gtov-2 1021517 n/a 1021523 unspecified role unspecified role prey prey n/a 1021522 unspecified role unspecified role bait bait c-terminal region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 2A ddx58-z-macv-1 1021517 n/a 1021522 unspecified role unspecified role bait bait n-terminal region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1021524 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2A ddx58-z-macv-2 1021517 n/a 1021524 unspecified role unspecified role prey prey n/a 1021522 unspecified role unspecified role bait bait c-terminal region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 2A ddx58-z-sabv-1 1021517 n/a 1021525 unspecified role unspecified role prey prey n/a 1021522 unspecified role unspecified role bait bait n-terminal region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2A ddx58-z-sabv-2 1021517 n/a 1021522 unspecified role unspecified role unspecified role unspecified role c-terminal region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1021525 unspecified role unspecified role unspecified role unspecified role physical association physical association false false false Fig. 2A z-gtov-ddx58 1021518 n/a 1021523 unspecified role unspecified role bait bait n-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1021522 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false Fig. 3A z-junv-ddx58 1021518 n/a 1021521 unspecified role unspecified role bait bait n-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1021522 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false Fig. 3A z-ddx58 1021518 n/a 1021522 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1021524 unspecified role unspecified role bait bait n-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false Fig. 3A ddx28-z-1 1021519 n/a 1021521 unspecified role unspecified role neutral component neutral component n/a 1021526 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Fig. 3B