DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ caillaud-2013-2 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Caillaud MC., Asai S., Rallapalli G., Piquerez S., Fabro G., Jones JD. DIP original experiment: DIP-256134X PLoS biology 2013 IMEx A downy mildew effector attenuates salicylic acid-triggered immunity in Arabidopsis by interacting with the host mediator complex. Caillaud MC., Asai S., Rallapalli G., Piquerez S., Fabro G., Jones JD. Only protein-protein interactions imex curation caillaud-2013-3 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Caillaud MC., Asai S., Rallapalli G., Piquerez S., Fabro G., Jones JD. DIP original experiment: DIP-256133X PLoS biology 2013 IMEx A downy mildew effector attenuates salicylic acid-triggered immunity in Arabidopsis by interacting with the host mediator complex. Caillaud MC., Asai S., Rallapalli G., Piquerez S., Fabro G., Jones JD. Only protein-protein interactions imex curation md19a_arath Mediator of RNA polymerase II transcription subunit 19a MED19_1 MXC9.19 At5g12230 MED19A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEPERLKFGGPRELCGAADLISQFKLVQHHEFFCKKSLPVSLSDSHYLHNVVGDTEIRKGEGMQLDQLIESISQSRETNIRIQPFDIDELQESFQLNDMTPVELPPAEKGAPTIPSKSKSESKDRDRKHKKHKDRDKDKDREHKKHKHKHKDRSKDKDKDKDRDRKKDKNGHHDSGDHSKKHHDKKRKHDGDEDLNDVQRHKKNKHKSSKLDEVGAIRVAG g3c9p1_hyaae RxL44 protein protein hyaae Hyaloperonospora arabidopsidis (strain Emoy2) Downy mildew agent Peronospora arabidopsidis AATVAASTHGLEVVPDPVKFSLLQATAETGHQADVDGKINRFLTSKDADLPHLVAPAGYAPSLLQKGGIGRYLRSTGVDDADLEERRGWHKHHKKHKKHKRKHHHHAHESSDSL med19a-rxl44-1 3261226 N/A 3261230 unspecified role unspecified role prey prey G3C9P1:p.[His92Asn;His93Ala;Lys94Ala;Lys95Ile;His96Arg;Lys97Ser] H92N/H93A/K94A/K95I/H96R/K97S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana N/A 3261229 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana physical association physical association false false false med19a-rxl44-2 3261227 N/A 3261230 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana N/A 3261229 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana physical association physical association false false false IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ we_ling-2014-2 Convergent targeting of a common host protein-network by pathogen effectors from three kingdoms of life. nicbe-leaf Nicotiana benthamiana leaf leaf leaf confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Weßling R., Epple P., Altmann S., He Y., Yang L., Henz S.R., McDonald N., Wiley K., Bader K.C., Gläßer C., Mukhtar M.S., Haigis S., Ghamsari L., Stephens A.E., Ecker J.R., Vidal M., Jones J.D., Mayer K.F., Ver Loren van Themaat E., Weigel D., Schulze-Lefert P., Dangl J.L., Panstruga R., Braun P. Submitted 18-07-2014 by Pascal Braun, Technische Universitaet Muenchen. In this re-localization assay the interaction partners change localization to a distinct pattern when co-expressed. pbraun@wzw.tum.de, panstruga@bio1.rwth-aachen.de, dangl@email.unc.edu Cell Host Microbe (1931-3128) 2014 Only protein-protein interactions imex curation a0a088qf98_9pezi OEC88 protein protein golovinomyces orontii golovinomyces orontii MLYVLSFHVKAQKNLSIPTAEPQAFVHNDVRCSFQMLRYRASNIKSSRDKGR tcp14_arath Transcription factor TCP14 TCP14 F1P2.170 At3g47620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQKPTSSILNVIMDGGDSVGGGGGDDHHRHLHHHHRPTFPFQLLGKHDPDDNHQQQPSPSSSSSLFSLHQHQQLSQSQPQSQSQKSQPQTTQKELLQTQEESAVVAAKKPPLKRASTKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGETIEWLLQQAEPSVIAATGTGTIPANFTSLNISLRSSGSSMSLPSHFRSAASTFSPNNIFSPAMLQQQQQQQRGGGVGFHHPHLQGRAPTSSLFPGIDNFTPTTSFLNFHNPTKQEGDQDSEELNSEKKRRIQTTSDLHQQQQQHQHDQIGGYTLQSSNSGSTATAAAAQQIPGNFWMVAAAAAAGGGGGNNNQTGGLMTASIGTGGGGGEPVWTFPSINTAAAALYRSGVSGVPSGAVSSGLHFMNFAAPMAFLTGQQQLATTSNHEINEDSNNNEGGRSDGGGDHHNTQRHHHHQQQHHHNILSGLNQYGRQVSGDSQASGSLGGGDEEDQQD a0a088qd79_9pezi OEC55 protein protein golovinomyces orontii golovinomyces orontii MFPAIPTRPIQHASHYRTIDDTPALIQLIYNVDNRQAECKDEHLTARKTFPPISLLAYLPETQNTSAH a0a088qtx9_9pezi OEC45 protein protein golovinomyces orontii golovinomyces orontii MQPNPNAAQPHPNAADCPYEGRICDKKDIEPYRSVKYLRATCKKCGKITNNNVVGKKNYKLRYCLYCDMKYIHDLSLRKTKMLYKCPDCETELR a0a088qcs8_9pezi OEC60 protein protein golovinomyces orontii golovinomyces orontii MEDLYDSSEGPRLKDQQLRAPFRIATAESTCSCATEYITYTGEGFRMLKILILILKRKF a0a088qd54_9pezi OEC16a protein protein golovinomyces orontii golovinomyces orontii MHIVTRSVSPRSESKSISIYVRIINTSEKPGKGGECDGENKSCSDTDSPKDECDGENKSCSDTDSLKDEKFWKVNRCKDGESSCSRRPTYRYGFRCNKKFFNQDKVMKAAEAACTKIGKNSQRQVFPAPYTESEYEKPGPYVEWPILRNGRIWNRFRRSKYRIVMTYDCTVVDAVIRHKNGESYTQCTVEPH a0a088qd58_9pezi OEC23a protein protein golovinomyces orontii golovinomyces orontii MVAVEPPTVPVFSSYRCPGNFEIPQDVLSKEATESCSKIREAYECNGLNRCFGFRTKPMISTPLATKYRGYNFELSPEEKIQNPSLYEWNMKKFSSETSERYKFLVIIKYIPRNEMCILRGVAMRSGKEEDECELKLPNR a0a088qd63_9pezi OEC27 protein protein golovinomyces orontii golovinomyces orontii MQPFDAYGVTHRGFSCDSYKFMNHEIYAQANFACMGGKLNHSILFNEKVRPLSESAGDYINRKFGDAKSQIIIYFAPLFRSNVEEMQNTFINQKKDVGPYRLVLNNNCDIITAITYESNKNEKTLDSTENIHACEKF a0a088qtx5_9pezi OEC39 protein protein golovinomyces orontii golovinomyces orontii MQPFDAYGVTHRGFSCGDHKFMNREIYAQVNFACMGGKLNSTITDNVNVRPQSTRVEVYVSDIMRDATSAGTIHFAPLFSSNVEEMQSMSYSHSFCL a0a088qf61_9pezi OEC23b protein protein golovinomyces orontii golovinomyces orontii MVAVELYYGSPDAVSIPSSYECGETSIPKYSLRIEATKGCSRIKRQCEGLNTCFGRLKRPIVGSSRAKIYKGHHFQISSEENDFKFPVYEWNMREFSSKFMEKNGYLVIMRFNPSLKRCDFKGVVMRTATTEMECDEKPPKHNRVTRISSPRFAPI atr1_hyara ATR1 protein Hyaloperonospora arabidopsidis protein protein hyaloperonospora arabidopsidis Hyaloperonospora arabidopsidis MRVCYFVLLPSVALAVIATESSETSRTIVHVFPLRDVADHRNDALINRALRAQAALDDDEERWPFGPLAVKALIRTIDSHRAGLNDDEAKMKEVVQTWNKLIERDNLIDEIGKHYSKAPGPVYDSYDEALATMLVTTYSYRGVARAILHPRPSDPISNKAGRAHRLEEAVASLWKERGYTSHNVVSNIATDDDVDFFASTAFTFLVKCVESEDDANNAIFEYFGSNPSRYFSAVLHAMEKPGADIRKLENSKKWMFRLYAQAPEPFSPPGFEWALARFQDEDHAFVGAQNDYKKLSPSQIEKLVEEYSGIYSVTSRNFVGRASE a0a088qd33_9pezi OEC103 protein protein golovinomyces orontii golovinomyces orontii MNIKAGFRASGILHFDPNAVSFQYDFVLSSPSILGTWSAFEMGRNYNQSPGSSLVIVSTLYRMPMRLRIPVR a0a088qtu0_9pezi OEC106 protein protein golovinomyces orontii golovinomyces orontii MFNPTCLTIIWKSKNTDCSGCFVNHNMIARSLQNACPRESNRGRLTNKFRELQLYEGNGIEGAVPRAMWQIGVPDAQDGTLYYLIIHWDKKLSQCHYLGAVMYEIEKKKYIPCIDKYSGHATPKSDRTA a0a088qtu4_9pezi OEC110 protein protein golovinomyces orontii golovinomyces orontii MTDIRQTKFEDRVWCHNEKEFSPEDINALALKGCAMLKLEKHPPDRCLRLSKCSSDRPEKVNNLKDYHHGRFVNQGENLYLIKIPSKKFIRKFYTMEDINTLAGPKLQNFLSAIFFRFFL a0a088qf47_9pezi OEC113 protein protein golovinomyces orontii golovinomyces orontii MSLYHSIVALGSSSGSVGFKVKHQDSKVCWSSRPSLKWVQLVTGCVKLEDCRTSFPKLADIMDFGVKKEVICTALLYEDFHRHLPMRKPPISEKNR g3c9n6_hyaae RxL18 protein protein hyaae Hyaloperonospora arabidopsidis (strain Emoy2) Downy mildew agent Peronospora arabidopsidis HRSPRNLRRVAAAGEENDVRMKALIPTTSISTTFEPEEERGITGGLTEKLRGFLKDVYLKRYARLQAANMNQAIAIKGLQKKKIRVDKLRRYLRLDKVKNHHLDDGNVSWNTLCFWRMKELY g3c9n7_hyaae RxL21 protein protein hyaae Hyaloperonospora arabidopsidis (strain Emoy2) Downy mildew agent Peronospora arabidopsidis RDTNSSRTRGSTVTNASLPAIFRSSVGNHNDVVVKRLLRAREIAADEERTPRKLPSFDKVISELFATLHVEETYPPDLGKKIINKLRTFDREAIKHYYEKQYEDPIMATKKLIEASSLKHQRTHGPFDMEMYREFYHDHLHKETWISHWVQDGLHKAELHPNVVFKMMINAEKRPVLGADSRSLFATTDLEALHKYIERFNEKEKSRTPASLRQTLSYCIRDEAGLASFLSIAKQNSINAPFVWKEQHRLFMGWIGHRKTIDQVADMMKIPGQWKDAKACPFLDTLIGYVTVFAQTYPAASTDIVSCLVIKFGHLYAAMLIGEAKEVNIDVFAELEKVLFQSWTKGGTNPLNFDQADFFAEITVGADDKALIREHFAEHYRKETPSHLMLTLN g3c9m6_hyaab RxL45 protein protein hyaloperonospora arabidopsidis Hyaloperonospora arabidopsidis PNSVKSSSLRSRVEARSQLDVNGRTTRFLTSDNHQATGHAASALHGKRSLRALSQAGKKKKGHHDDAETEAAEEEEEEDDDSTSESSSGSSDDSSSVSSSDS rx106_hyaae Secreted RxLR effector protein 106 RXL106 protein protein hyaae Hyaloperonospora arabidopsidis (strain Emoy2) Downy mildew agent Peronospora arabidopsidis MSVRYAGLLLAAVAVSAHINEVNSIVFPGSLHIDNRNGHVQRDLRSADNGNEERNAILETLSNHLASAFGYLWTKEAQEMTNSAWSALRNKESSLPLYSEGVAREYIETAALNTLTAEHRLARAEAYMVSMIVALRGVENPESLRNSADNLQQFLINVWKTGKKQPAQVFELLEHVPYEEGNASLVNDSKFAIWMAYMGKTFDHQFKNWADVQHNEQLRIEGDKEKKGGPDYVEGTESRGKKRGQTEAPDLEPGLTPKQKRLKRMELQRVKKILLNINLMGIGRS g3c9r9_hyaae RxL146 protein protein hyaae Hyaloperonospora arabidopsidis (strain Emoy2) Downy mildew agent Peronospora arabidopsidis ELSRPVQARRTLRTEGGTITTAEQGPNPTHGTSTLVETQSSIQEERRNGGLLGLFRRKMDFKTFTSYLQLLGIRMTTKFKKLAVKGLAGLSKRKIVLGGFLSKVKLVV crn4b_hyaae CRN4b protein Hyaloperonospora arabidopsidis (strain Emoy2) (Downy mildew agent) protein protein hyaae Hyaloperonospora arabidopsidis (strain Emoy2) Downy mildew agent Peronospora arabidopsidis MVQVTLLCAIVGVPRCVSAVKIDTNEVVGILKKAIKEDNAVDVRCDARKLRLFLAKKDGVWLRDDGDLDKLIQTEGFLDGMEEMRASWELSDPSLFGTGVMLGKKVVHVLVVLPRTMASPLGESITVGGVTIPVTSTMRNSPRVDFWKALQKIKTPVVADAVITLPEKTFILDESELGSHIYIRHCYPHLWDICRSILDGKKGTYKRLIILGTPGIGKTYFCFLVLLFLAQDGATVIYESSEVEGERTLFSGDLVIKGLHTDFSEVLEQRETFYVVDGVKPSRVKAKTMLVTSPRKKVWHKIFQRNCARLFMPVWSKQEIFKCRELLYSNTPVEIVEKRYMKWGGVARYVLQYAEDKALQKVLKEAITKSNLQTILTASVESSGVESDVSHRLLHFRVNRDFCYKCLDFASVYVAQKVFERLYERGRRDLIDFLAASHQLSEDAVKRGILFERFALSVLSQGGTFESRQLKPKDSATGGDEDECKSNCVGVDSDGDVTMYKRAESGCVKLRPRKSLFFKGVCEVTRADVGKFLQPASRNFESVDAMAKPDELFQVTCAQVHPCKHNGLLKALEMLGNPDEPRLYFVVPPDVFEGFEYQDYHTVKGEKVKIIDKRLKKLEQHVIKIDFSYEIRLAKKSADSRSSSCEEEGEERSGQSGASKCARPGSS hopbb1_psesmori HopBB1 protein Pseudomonas syringae pv. mori protein protein psesm_str_301020 Pseudomonas syringae pv. mori str. 301020 MLFVGNICGTSGSHYVYSPPVSPRHVSGSSTPVHSVGGQGLTSVYQLSAEARDDFLDRFDPMRNLGLNSETPLYRTTDTSWRNVIAQVRNPDEDPRIDYLLTMAEEIYKASSTFRKRMNAVAGEGGVTIRIVPDSEIGHSFGHAATRPATRSIALTETTASNVQGSHYQSLNILLVELSNLSRANEITENRSSFQQGRIGQRRAAHNAERAEYGTIEDMVKYFTEARPVIESLGYGNPSMWYAAHDYGGGIVPAYRSFEDYYATALSSGHTDVHLNNYSRSDE a0a088qcn4_9pezi OEC101 protein protein golovinomyces orontii golovinomyces orontii MVNIIVSSYAGQITSLSLRQTEDGEQTLTKLSVINSPMPQPSWLEKSGETIFLANENFAGPNGSLLPLKINETGELIATQQFMNTPAGPVSIVAFNQGKALAVAH hopbb1_psesmori-tcp14-1 1570173 q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false not-defined-156158502 HopBB1 1570281 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 4c km220816-tcp14 1570173 q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false not-defined-23428160 OEC113 1570275 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure S4G km220813-tcp14 1570173 not-defined-1641316877 OEC110 1570277 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure S4F km220808-tcp14 1570173 not-defined-453175653 OEC106 1570278 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure S4F km220805-tcp14 1570173 not-defined-397483938 OEC103 1570279 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure S4G km220804-tcp14 1570173 q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false not-defined-1460040395 OEC101 1570280 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure S4F km220881-tcp14 1570173 q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false not-defined-585787442 OEC88 1570179 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure S4F km220864-tcp14 1570173 q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false not-defined-591839355 OEC60 1570222 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure S4F km220860-tcp14 1570173 not-defined-623852244 OEC55 1570228 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure S4F km220853-tcp14-1 1570173 not-defined-1259316535 OEC45 1570233 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 4c km220848-tcp14 1570173 q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false not-defined-1609458065 OEC39 1570245 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure S4F km220840-tcp14 1570173 not-defined-1562056419 OEC27 1570247 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure S4F km220836-tcp14 1570173 q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false not-defined-916428370 OEC23b 1570255 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure S4F km220835-tcp14 1570173 q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false not-defined-1214576053 OEC23a 1570256 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure S4F km220830-tcp14 1570173 not-defined-398674527 OEC16a 1570258 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure S4F crn4b_hyaae-tcp14 1570173 not-defined-818844984 CRN4b 1570282 unspecified role unspecified role neutral component neutral component c-terminal cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure S4E ccc55845_1-tcp14 1570173 q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false g3c9r9 HaRxL146 1570283 unspecified role unspecified role neutral component neutral component c-terminal cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure S4E ccc55840_1-tcp14 1570173 q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false g3c9r4 HaRxL106 1570284 unspecified role unspecified role neutral component neutral component n-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Figure S4E ccc55802_1-tcp14-1 1570173 g3c9m6 HaRxL45 1570285 unspecified role unspecified role neutral component neutral component n-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 4c ccc55813_1-tcp14 1570173 q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false g3c9n7 HaRxL21 1570286 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure S4E ccc55812_1-tcp14 1570173 g3c9n6 HaRxL18 1570287 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure S4E atr1_hyara-tcp14 1570173 not-defined-1665893026 ATR1 1570288 unspecified role unspecified role neutral component neutral component c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false q93z00 AT3G47620 1570176 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure S4E