DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ britton-2006-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Britton KL., Baker PJ., Fisher M., Ruzheinikov S., Gilmour DJ., Bonete MJ., Ferrer J., Pire C., Esclapez J., Rice DW. DIP original experiment: DIP-262771X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Analysis of protein solvent interactions in glucose dehydrogenase from the extreme halophile Haloferax mediterranei. Britton KL., Baker PJ., Fisher M., Ruzheinikov S., Gilmour DJ., Bonete MJ., Ferrer J., Pire C., Esclapez J., Rice DW. Only protein-protein interactions imex curation baker-2009-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Baker PJ., Britton KL., Fisher M., Esclapez J., Pire C., Bonete MJ., Ferrer J., Rice DW. DIP original experiment: DIP-133623X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Active site dynamics in the zinc-dependent medium chain alcohol dehydrogenase superfamily. Baker PJ., Britton KL., Fisher M., Esclapez J., Pire C., Bonete MJ., Ferrer J., Rice DW. Only protein-protein interactions imex curation glcdh_halmt Glucose 1-dehydrogenase gdh HFX_1090 protein protein halmt Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) Halobacterium mediterranei MKAIAVKRGEDRPVVIEKPRPEPESGEALVRTLRVGVDGTDHEVIAGGHGGFPEGEDHLVLGHEAVGVVVDPNDTELEEGDIVVPTVRRPPASGTNEYFERDQPDMAPDGMYFERGIVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEKALEHAYASRSAFDWDPSSAFVLGNGSLGLLTLAMLKVDDKGYENLYCLGRRDRPDPTIDIIEELDATYVDSRQTPVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFEVDAGAFHREMVLHNKALVGSVNSHVEHFEAATVTFTKLPKWFLEDLVTGVHPLSEFEAAFDDDDTTIKTAIEFSTV gdh-1 3142973 N/A 3142974 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false glcdh-1 3182429 N/A 3142974 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint anonymous-2014e-1 The structure of a PII signaling protein from a halophilic archaea reveals novel traits and high-salt adaptations in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined cpalanca@ibv.csic.es; rubio@ibv.csic.es 2014 imex curation Palanca C., Pedro-Roig L., Llácer J.L., Camacho M., Bonete M.J., Rubio V. FEBS J. (1742-464X) Only protein-protein interactions glnk2_halmt Nitrogen regulatory protein GlnK2 glnK2 C439_09930 BM92_08825 E6P09_03555 HFX_0092 protein protein halmt Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) Halobacterium mediterranei MSDADLPNDGGIKLVMAIIRPDKLADVKTALAEVGAPSLTVTNVSGRGSQPAKKSQWRGEEYTVDLHQKVKVECVVADTPAEDVADAIADAAHTGEKGDGKIFILPVENAIQVRTGKTGRDAV glnk2 1547381 n/a hmGlnK2 1547382 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 3.0 direct interaction direct interaction false false false t1 f2