IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ruokolainen-2010-2 Large scale interaction analysis predicts that the Gerbera hybrida floral E function is provided both by general and specialized proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast protein three hybrid protein three hybrid trihybrid bridge assay protein 3-hybrid protein tri hybrid trihybrid bridge assay predetermined predetermined participant predetermined Ruokolainen S., Ng YP., Albert VA., Elomaa P., Teeri TH. teemu.teeri@helsinki.fi BMC Plant Biol. 2010 Only protein-protein interactions imex curation ruokolainen-2010-1 Large scale interaction analysis predicts that the Gerbera hybrida floral E function is provided both by general and specialized proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined Ruokolainen S., Ng YP., Albert VA., Elomaa P., Teeri TH. teemu.teeri@helsinki.fi BMC Plant Biol. 2010 Only protein-protein interactions imex curation q9zs25_gerhy gsqua1 protein protein gerhy Gerbera hybrida MGRGKVQLKRIENKINRQVTFSKRRGGLLKKAHEISVLCDAEVALIVFSAKGKLFEYSTDSCMENILDRYEQYSNIDRQHVAVDTDSPIRWTQECNKLKSRAELLQRNLRHYMGEDIESLGLREIQNLEQQLDTALKRIHSKKNQLLHQSISELQKKEKAIQEQNNTLIKNIKEKEKTITQKAQWEPHNYGPNTTPLLFSLPPHSSLNIG q9fst1_gerhy grcd1 protein protein gerhy Gerbera hybrida MGKGRLELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSTRGKLYEFSSTSSMLKTLERYEKCSFGPPEQRRPAAKEDLQEQSSYQEYMRLKERYDALKRLERNYYGEEIDSLTTSELESLERQLHCSLKQIRTIRTQSLLDKLYEQQKMEHQLYESNKTLRLRLDEEGQAEALQWDAHAHANGMVYAHQHQVSQPMRDTFYHPTGCETTLQIGYQSEQMSAVNHQMQGWPA d2t2g1_gerhy gsqua3 protein protein gerhy Gerbera hybrida MGRGKVQLRRIENKITRQVTFSKRRGGLLKKAHEISVLCDAEVALIVFSNKGKLFEFSTDSCMESILERYERYSYTERQLVSADTAPRSWTLEYNKLKSRAELLQRNHRHYMGEDIESLSLKEIQNLEQQLDTGLKNIRSRKNQLLHESISELQKKGKAIQEQNTTLTKKIKEKEKEKTITQNAQWEHHTFVDHDTTFLMPPPPPTMNIGGTYNQDGGGGVEAVEGRSNELDLSLQPIYSCHLRCFPS q6euv7_gerhy grcd2 protein protein gerhy Gerbera hybrida MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLFEFCSTSNMLKMLERYQNCTYGSMEVDRSTPNAEQSSYKEYMKLKAKYESLQQYQRQLFGEDLGPLSLKELEQLERQLDSTLRQIRSIRTQSMLDRLSELQVKERMWVEANKALQNKLEEVYAENQAGPSWAAGEHHSSYGQEHQHQHQSQGFFQPLDCNSNLQIGYNTVDSSHITASTNGQNLNGLIPGWML d2t2g0_gerhy gsqua2 protein protein gerhy Gerbera hybrida MGRGRVQLKRIENKISRQVTFSKRRTGLLKKAHEISVLCDADVALIVFSTKGKLFEYSTHSSMDAILERYERYSYAEKLLTAPETETQGSWTLESSKLRAKIEVLEKNIKHYVGEDLEPLNLRELQSVEQQIETALKRVRTRKNQVMHESISELHKKERSLQEQNNTLSKKLKGNQKNTEQQNVGFMFPPQPHHLAHPAIGSGSFEGGGAVREEEYSTQAHPISGTMMPPWLFHHIYQ d2t2f8_gerhy grcd4 protein protein gerhy Gerbera hybrida MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMVKTLEKYHSCSYGSLKASQPENESQYNYHEYLRLKARVEVLQRSQRNLLGEDLAPLNTKELEQLEHQLEMSLRKIRSTKTQSMLDQLADLQRKEQVLAETNKALRKKLEESAQEYPVRQMWEGGAQTIPYNPLPTHSDEFFQPLGLNSTMHNSFNGLRYNPIVSDEMNVAGANNNSPNGLFPGWML d2t2g2_gerhy gsqua5 protein protein gerhy Gerbera hybrida MGRGRVMLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDADVALIVFSTRGKLCEYATDASMERILERYERYSYAERQLTATDNESHGSWTMEHAKLKSRTELLQKTQRHFMGEELDSLSLKELQNLEQQLDTALKHIRLRKNQLMFESISVLQKKDKALQNQNNFLSKKVKEVEKELAQQPPLEQQNPENMSSFQFSAYISIGCGEGGDGAVAEMEKQAQPSTSMPPWMLQHMNQ q6euv6_gerhy grcd3 protein protein gerhy Gerbera hybrida MGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVGLIIFSSRDKLYEFGSVGVMKTLERYQRCCFNPQDNNNERETQSWYQEVSKLKAKFESLQRTQRHLLGEDLGPLSVKELHNLEKQLEGALTQARQRKTQIMVEQMEELRRKERELGDMNKHLKIKVSHELSTFDAEGQGYRAQLPCPWNSGTNNTFTMHPSQSNPMDCQQEPILQIGYNQFMHGEGSSVQRNMVGENGIHGWVL d2t2f9_gerhy grcd5 protein protein gerhy Gerbera hybrida MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSSSSMLKTLERYQKCNYGAPDQTNVSAREALELSSQQEYLKLKARYEALQRSQRNLLGEDLGPLNCKELESLERQLDTSLKHIRSARTQLMLDTLTDLQKKEHALNEANRTLKQRLIEGTQINSLHWYPQAPQEVCYDDRQHAPQHQTDEAFFHPLDCGPTLQIGYQTDPINVAGAEAVAGPSMNNYMQGWLPC q9zs26_gerhy gglo1 protein protein gerhy Gerbera hybrida MGRGKIEIKRIENTSNRQVTYSKRKNGIIKKAKEITVLCDANVSLVIYGSSGKMYEYCSPKTNLIDMLDRYQRLSGNKLWDAKHENLQNEIDRIKKENESMQIELRHLKGEDITSLNYEELIAYEDALENGLTNIREKKDEIPKIMRKHEQVLEEENKHLMYLVQQSEMAAMGDYQAAHEPFSFRVQPMQPNLHERM q9zs28_gerhy gdef1 protein protein gerhy Gerbera hybrida MGRGKIEIKKIENNTNRQVTYSKRRNGIFKKAHELTVLCDAKVSLIMFSNTGKFHEYISPSTTTKKMYDQYQSTVGFDLWSSHYERMKETMKKLKDTNNKLRREIRQRVLGEDFDGLDMNDLTSLEQHMQDSLTLVRERKYHVIKTQTDTCRKRVRNLEQRNGNLRLDYETIHQLDKKYDTGENEGDYESVVAYSNGVSNLYAFCVHPNNIPHGAGYELHDHQHTN q9zs27_gerhy gdef2 protein protein gerhy Gerbera hybrida MARGKIQIKKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYISPSITTKQFFDQYQKASGIDLWNSHYEKMQEELRQLKEVNRNLRRQIRQRLGDCLEDLGFEEFLDLEKESQEAVYIIRERKLKVIGNKLETSKKKVRSAQDVYKKLMHEFDIRGEDPQYGMIEDGVEYEALYGYPPHISAPRILTLRLQPNHPDNLHAAASDLTTYALLG q9zs30_gerhy gaga1 protein protein gerhy Gerbera hybrida MENSDVLELDFSCVDRSMSFPDDTGDMSPQRKMGKGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKGTIDKYKKACLDPPTSGTVAEANTQYYQQEAAKLRQQIANLQNQNRQFYRNIMGESLGDMPVKDLKNLEGKLEKAISRIRAKKNELLFAEIEYMQKRELELHNSNQFLRAKIVENERAQQHHMSLMPGSSDYELVTPHQPFDGRNYLQTNDLQPNNDYSCQDQTPLQLV q9zs29_gerhy GAGA2 protein protein gerhy Gerbera hybrida MSFPNDSGEMSPQRKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSVKGTIDRYKKACLDPPSSGSVAEANAQFYQQEAAKLRQQIANLQNQNRQFYRNIMGESLGNMPAKDLKNLESKLEKGIGKIRSKKNEILFAEIEYMQKRENELHNSNQFLRSKIAENERAQQHMSLMPGSSDYELVAPHQPFDGRNYLQVNDLQPNNNYSCQDQTPLQLV not-defined-331749888 972226 q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role bait bait q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-914379136 972226 q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role bait bait d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1623775098 972226 q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role bait bait q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1494620989 972226 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role bait bait d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1333871093 972226 d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1021072556 972226 d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role bait bait q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 d2t2g0-q6euv6 972226 q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1807900166 972226 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-457822151 972226 d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role bait bait q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-3380796 972226 d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-7929453 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-518820477 972226 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role bait bait d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1208957807 972226 q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary q6euv7_gerhy GRCD2 972231 unspecified role unspecified role prey prey q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1147818301 972226 q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary q6euv6_gerhy GRCD3 972235 unspecified role unspecified role prey prey q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-615359393 972226 q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role prey prey q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-2008086356 972226 q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role prey prey q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1025062148 972226 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role prey prey q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-612501359 972226 q6euv6_gerhy GRCD3 972235 unspecified role unspecified role prey prey q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-368481660 972226 q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role prey prey q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1317026161 972226 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role prey prey q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-2049846213 972226 q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-7723147 972226 q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-923490387 972226 q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-71078745 972226 q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1663415923 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role bait bait q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary q9fst1_gerhy GRCD1 972229 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-712203248 972226 q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary q9zs28_gerhy GDEF1 972238 unspecified role unspecified role prey prey q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1816043081 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait q9zs27_gerhy GDEF2 972239 unspecified role unspecified role prey prey q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1123202108 972226 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait q9zs26_gerhy GGLO1 972237 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1823912518 972226 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary q9zs28_gerhy GDEF1 972238 unspecified role unspecified role prey prey q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-890647782 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary q9zs27_gerhy GDEF2 972239 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1457671161 972226 q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait q9zs28_gerhy GDEF1 972238 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-447387814 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary q9zs27_gerhy GDEF2 972239 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-749231400 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait q9zs28_gerhy GDEF1 972238 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-903043514 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait q9zs27_gerhy GDEF2 972239 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1823034739 972226 q9zs28_gerhy GDEF1 972238 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-74189026 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary q9zs27_gerhy GDEF2 972239 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-562174890 972226 q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary q9zs28_gerhy GDEF1 972238 unspecified role unspecified role prey prey q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-712603622 972226 q9zs27_gerhy GDEF2 972239 unspecified role unspecified role prey prey q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-3384052 972226 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary q9zs26_gerhy GGLO1 972237 unspecified role unspecified role prey prey q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1514887225 972226 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait q9zs28_gerhy GDEF1 972238 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1156539242 972226 q9zs27_gerhy GDEF2 972239 unspecified role unspecified role prey prey q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-553182050 972226 q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary q9zs26_gerhy GGLO1 972237 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1320368403 972226 q9zs27_gerhy GDEF2 972239 unspecified role unspecified role prey prey q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-999232105 972226 q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait q9zs28_gerhy GDEF1 972238 unspecified role unspecified role prey prey d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-129441945 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary q9zs27_gerhy GDEF2 972239 unspecified role unspecified role prey prey q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-4038558 972226 q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-826969450 972226 q9zs26_gerhy GGLO1 972237 unspecified role unspecified role bait bait q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1244273310 972226 d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-2061032067 972226 q9zs26_gerhy GGLO1 972237 unspecified role unspecified role bait bait q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1411804169 972226 q9zs26_gerhy GGLO1 972237 unspecified role unspecified role bait bait q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-427215501 972226 d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-32729253 972226 q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-2097377759 972226 q9zs26_gerhy GGLO1 972237 unspecified role unspecified role bait bait q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1252059313 972226 q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1642826575 972226 q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-721385224 972226 q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-276287238 972226 q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary q9zs26_gerhy GGLO1 972237 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-627144998 972226 d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1838025406 972226 q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1834238120 972226 q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-838708347 972226 q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1756523515 972226 q9zs26_gerhy GGLO1 972237 unspecified role unspecified role bait bait d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-926277352 972226 q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1065795553 972226 d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1975411425 972226 q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1788712843 972226 q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1531837081 972226 q9zs26_gerhy GGLO1 972237 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-349615547 972226 d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1366245284 972226 q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1306117479 972226 d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-466628370 972226 q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-668625222 972226 q9zs26_gerhy GGLO1 972237 unspecified role unspecified role bait bait d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-47335650 972226 d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1956661121 972226 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1498569432 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role prey prey q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1706485544 972226 q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary q9zs29_gerhy GAGA2 972241 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-413039068 972226 q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait q9zs30_gerhy GAGA1 972240 unspecified role unspecified role prey prey q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-577203425 972226 q9zs29_gerhy GAGA2 972241 unspecified role unspecified role prey prey q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1766168621 972226 d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-2130906353 972226 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1168800127 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1496040172 972226 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-2112853223 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1629112276 972226 q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1198482663 972226 q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1494518826 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-889274681 972226 q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-377409525 972226 q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-466454285 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-664875083 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1217759094 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-488718865 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1744964122 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-257733383 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-905165484 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1409585374 972226 q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-915193321 972226 d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-690034143 972226 q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-299165623 972226 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-210670949 972226 q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-2022735438 972226 q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-88292584 972226 q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-899882297 972226 q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1706318366 972226 d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-849387948 972226 q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-55522878 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-246937706 972226 q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1065577859 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1684403890 972226 q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-840306260 972226 d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-501562330 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait q9zs30_gerhy GAGA1 972240 unspecified role unspecified role prey prey q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-30804321 972226 q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait q9zs29_gerhy GAGA2 972241 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1578045195 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait q9zs30_gerhy GAGA1 972240 unspecified role unspecified role prey prey q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1592596451 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait q9zs29_gerhy GAGA2 972241 unspecified role unspecified role prey prey q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-835510212 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1817474975 972226 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait q9zs29_gerhy GAGA2 972241 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1088928044 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role bait bait q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary q9zs30_gerhy GAGA1 972240 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1585974021 972226 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary q9zs30_gerhy GAGA1 972240 unspecified role unspecified role prey prey d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1516559225 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role bait bait q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary q9zs30_gerhy GAGA1 972240 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1541515709 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary q6euv6_gerhy GRCD3 972235 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1284724546 972226 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role bait bait q9zs30_gerhy GAGA1 972240 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-402143214 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-402558593 972226 q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait q9zs29_gerhy GAGA2 972241 unspecified role unspecified role prey prey q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-622118004 972226 q9zs29_gerhy GAGA2 972241 unspecified role unspecified role prey prey q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-2096965966 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role prey prey q9fst1_gerhy GRCD1 972229 unspecified role unspecified role ancillary ancillary q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-135260981 972226 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role prey prey q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1686431105 972226 q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role prey prey q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-452692279 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role prey prey d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-741173489 972226 q6euv6_gerhy GRCD3 972235 unspecified role unspecified role bait bait q9zs29_gerhy GAGA2 972241 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1312240120 972226 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role bait bait q9zs29_gerhy GAGA2 972241 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1730065939 972226 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary q9zs26_gerhy GGLO1 972237 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1408804382 972226 q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary q9zs28_gerhy GDEF1 972238 unspecified role unspecified role prey prey q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-2033164923 972226 q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary q9zs27_gerhy GDEF2 972239 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1475910394 972226 q9zs27_gerhy GDEF2 972239 unspecified role unspecified role prey prey q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait q9zs26_gerhy GGLO1 972237 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-284740243 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role bait bait q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary q9zs27_gerhy GDEF2 972239 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1653966429 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role bait bait q9zs27_gerhy GDEF2 972239 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-763698429 972226 q9zs27_gerhy GDEF2 972239 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role bait bait d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-558497020 972226 q9fst1_gerhy GRCD1 972229 unspecified role unspecified role bait bait q9fst1_gerhy GRCD1 972229 unspecified role unspecified role prey prey q9zs30_gerhy GAGA1 972240 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1571623673 972226 q9zs29_gerhy GAGA2 972241 unspecified role unspecified role ancillary ancillary q9fst1_gerhy GRCD1 972229 unspecified role unspecified role bait bait q9fst1_gerhy GRCD1 972229 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1090057925 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role ancillary ancillary q6euv7_gerhy GRCD2 972231 unspecified role unspecified role prey prey q9fst1_gerhy GRCD1 972229 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-280849241 972226 q9zs29_gerhy GAGA2 972241 unspecified role unspecified role ancillary ancillary q6euv7_gerhy GRCD2 972231 unspecified role unspecified role prey prey q9fst1_gerhy GRCD1 972229 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1632176156 972226 q9fst1_gerhy GRCD1 972229 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role bait bait q9zs30_gerhy GAGA1 972240 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-443826632 972226 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role bait bait q9fst1_gerhy GRCD1 972229 unspecified role unspecified role prey prey q9zs29_gerhy GAGA2 972241 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1360321424 972226 q9fst1_gerhy GRCD1 972229 unspecified role unspecified role bait bait q6euv7_gerhy GRCD2 972231 unspecified role unspecified role prey prey q9zs30_gerhy GAGA1 972240 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-238877653 972226 q9fst1_gerhy GRCD1 972229 unspecified role unspecified role bait bait q9zs29_gerhy GAGA2 972241 unspecified role unspecified role ancillary ancillary q6euv7_gerhy GRCD2 972231 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1055570032 972226 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role ancillary ancillary q6euv7_gerhy GRCD2 972231 unspecified role unspecified role bait bait q6euv7_gerhy GRCD2 972231 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-650342355 972226 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role bait bait q6euv7_gerhy GRCD2 972231 unspecified role unspecified role prey prey q9zs29_gerhy GAGA2 972241 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1560920224 972226 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role prey prey q6euv7_gerhy GRCD2 972231 unspecified role unspecified role bait bait q9zs30_gerhy GAGA1 972240 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-160399889 972226 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role prey prey q9zs29_gerhy GAGA2 972241 unspecified role unspecified role ancillary ancillary q6euv7_gerhy GRCD2 972231 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-967842680 972226 q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary q6euv7_gerhy GRCD2 972231 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-2055986681 972226 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey q6euv7_gerhy GRCD2 972231 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1649508295 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey q6euv7_gerhy GRCD2 972231 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1330653932 972226 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role bait bait d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1566609845 972226 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role prey prey q9zs30_gerhy GAGA1 972240 unspecified role unspecified role ancillary ancillary q6euv6_gerhy GRCD3 972235 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-1014471360 972226 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role prey prey q6euv6_gerhy GRCD3 972235 unspecified role unspecified role bait bait q9zs29_gerhy GAGA2 972241 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-862387042 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary q6euv6_gerhy GRCD3 972235 unspecified role unspecified role bait bait q6euv7_gerhy GRCD2 972231 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-306806522 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary q6euv6_gerhy GRCD3 972235 unspecified role unspecified role prey prey q6euv6_gerhy GRCD3 972235 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-2020173276 972226 q6euv6_gerhy GRCD3 972235 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role ancillary ancillary q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-672319517 972226 d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role prey prey q6euv6_gerhy GRCD3 972235 unspecified role unspecified role bait bait d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 not-defined-1797094960 972226 d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role bait bait d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-984343772 972226 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role prey prey d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role bait bait q6euv7_gerhy GRCD2 972231 unspecified role unspecified role ancillary ancillary physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S2 and Fig 4 2 not-defined-321502567 972226 q6euv6_gerhy GRCD3 972235 unspecified role unspecified role ancillary ancillary d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S2 and Fig 4 1 grcd1-gaga1 972227 q9fst1_gerhy GRCD1 972229 unspecified role unspecified role bait bait q9zs30_gerhy GAGA1 972240 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 grcd2-gaga1 972227 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role bait bait q9zs30_gerhy GAGA1 972240 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 grcd5-gaga1 972227 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 grcd1-gaga2 972227 q9fst1_gerhy GRCD1 972229 unspecified role unspecified role bait bait q9zs29_gerhy GAGA2 972241 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 grcd2-gaga2 972227 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role bait bait q9zs29_gerhy GAGA2 972241 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 grcd5-gaga2 972227 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role bait bait q9zs29_gerhy GAGA2 972241 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S5 and Fig 3 1 gdef2-gglo1 972227 q9zs27_gerhy GDEF2 972239 unspecified role unspecified role bait bait q9zs26_gerhy GGLO1 972237 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 gdef1-gglo1 972227 q9zs26_gerhy GGLO1 972237 unspecified role unspecified role prey prey q9zs28_gerhy GDEF1 972238 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 gglo1-gdef2 972227 q9zs26_gerhy GGLO1 972237 unspecified role unspecified role bait bait q9zs27_gerhy GDEF2 972239 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 gaga1-grcd1 972227 q9fst1_gerhy GRCD1 972229 unspecified role unspecified role prey prey q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S5 and Fig 3 1 gaga2-grcd1 972227 q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait q9fst1_gerhy GRCD1 972229 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S5 and Fig 3 1 gaga1-grcd2 972227 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role prey prey q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S5 and Fig 3 1 gaga2-grcd2 972227 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role prey prey q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 gsqua2-grcd2 972227 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role prey prey d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 grcd5-grcd3 972227 q6euv6_gerhy GRCD3 972235 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S5 and Fig 3 1 grcd2-gsqua2 972227 d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey q6euv7_gerhy GRCD2 972231 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 grcd5-gsqua2 972227 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role bait bait d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S5 and Fig 3 1 grcd5-gsqua5 972227 d2t2g2_gerhy GSQUA5 972234 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S5 and Fig 3 1 grcd4-gsqua1 972227 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role bait bait q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S5 and Fig 3 1 grcd5-gsqua1 972227 q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role prey prey d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S5 and Fig 3 1 gglo1-gdef1 972227 q9zs28_gerhy GDEF1 972238 unspecified role unspecified role prey prey q9zs26_gerhy GGLO1 972237 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 gaga2-grcd4 972227 q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 grcd2-grcd4 972227 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role prey prey q6euv7_gerhy GRCD2 972231 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S5 and Fig 3 1 grcd3-grcd4 972227 q6euv6_gerhy GRCD3 972235 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 gsqua2-grcd4 972227 d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 gsqua3-grcd4 972227 d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S5 and Fig 3 1 gsqua1-grcd4 972227 q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 grcd4-grcd4 972227 d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 grcd5-grcd4 972227 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role bait bait d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 gaga1-grcd5 972227 q9zs30_gerhy GAGA1 972240 unspecified role unspecified role bait bait d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 gaga2-grcd5 972227 q9zs29_gerhy GAGA2 972241 unspecified role unspecified role bait bait d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 grcd2-grcd5 972227 q6euv7_gerhy GRCD2 972231 unspecified role unspecified role bait bait d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S5 and Fig 3 1 grcd3-grcd5 972227 q6euv6_gerhy GRCD3 972235 unspecified role unspecified role bait bait d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 gsqua2-grcd5 972227 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role prey prey d2t2g0_gerhy GSQUA2 972232 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 gsqua3-grcd5 972227 d2t2g1_gerhy GSQUA3 972230 unspecified role unspecified role bait bait d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table S5 and Fig 3 1 gsqua1-grcd5 972227 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role prey prey q9zs25_gerhy GSQUA1 972228 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 grcd4-grcd5 972227 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role prey prey d2t2f8_gerhy GRCD4 972233 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2 grcd5-grcd5 972227 d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role bait bait d2t2f9_gerhy GRCD5 972236 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table S5 and Fig 3 2