MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint fraga-2010-1 FH8--a small EF-hand protein from Fasciola hepatica. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom predetermined predetermined participant predetermined Fraga H., Faria TQ., Pinto F., Almeida A., Brito RM., Damas AM. FEBS J. (1742-464X) 2010 fraga-2010-2 FH8--a small EF-hand protein from Fasciola hepatica. in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Fraga H., Faria TQ., Pinto F., Almeida A., Brito RM., Damas AM. FEBS J. (1742-464X) 2010 q9nig5_fashe D915_000539 D915_00786 protein protein fashe Fasciola hepatica MPSVQEVEKLLHVLDRNGDGKVSAEELKAFADDSKCPLDSNKIKAFIKEHDKNKDGKLDLKELVSILSS mint q9nig5 992617 q9nig5_fashe F8 992619 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false f1a mint q9nig5-1 992618 q9nig5_fashe FH8 992619 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 disulfide bond disulfide bond disulfide bridge SS-bond false false false f7c mint