DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ morar-2009-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Morar M., Bhullar K., Hughes DW., Junop M., Wright GD. DIP original experiment: DIP-131964X Structure (London, England : 1993) 2009 IMEx Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB. Morar M., Bhullar K., Hughes DW., Junop M., Wright GD. Only protein-protein interactions imex curation morar-2009-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Morar M., Bhullar K., Hughes DW., Junop M., Wright GD. DIP original experiment: DIP-131965X Structure (London, England : 1993) 2009 IMEx Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB. Morar M., Bhullar K., Hughes DW., Junop M., Wright GD. Only protein-protein interactions imex curation derome-2008-1 in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Derome A., Hoischen C., Bussiek M., Grady R., Adamczyk M., Kedzierska B., Diekmann S., Barillà D., Hayes F. DIP original experiment: DIP-68258X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Centromere anatomy in the multidrug-resistant pathogen Enterococcus faecium. Derome A., Hoischen C., Bussiek M., Grady R., Adamczyk M., Kedzierska B., Diekmann S., Barillà D., Hayes F. Only protein-protein interactions imex curation derome-2008-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Derome A., Hoischen C., Bussiek M., Grady R., Adamczyk M., Kedzierska B., Diekmann S., Barillà D., Hayes F. DIP original experiment: DIP-68259X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Centromere anatomy in the multidrug-resistant pathogen Enterococcus faecium. Derome A., Hoischen C., Bussiek M., Grady R., Adamczyk M., Kedzierska B., Diekmann S., Barillà D., Hayes F. Only protein-protein interactions imex curation derome-2008-3 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Derome A., Hoischen C., Bussiek M., Grady R., Adamczyk M., Kedzierska B., Diekmann S., Barillà D., Hayes F. DIP original experiment: DIP-68260X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Centromere anatomy in the multidrug-resistant pathogen Enterococcus faecium. Derome A., Hoischen C., Bussiek M., Grady R., Adamczyk M., Kedzierska B., Diekmann S., Barillà D., Hayes F. Only protein-protein interactions imex curation derome-2008-4 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Derome A., Hoischen C., Bussiek M., Grady R., Adamczyk M., Kedzierska B., Diekmann S., Barillà D., Hayes F. DIP original experiment: DIP-68261X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx Centromere anatomy in the multidrug-resistant pathogen Enterococcus faecium. Derome A., Hoischen C., Bussiek M., Grady R., Adamczyk M., Kedzierska B., Diekmann S., Barillà D., Hayes F. Only protein-protein interactions imex curation a1jv32_entfc F6440_15665 B4W81_16680 B4W81_17555 DPX30_16035 EB44_02731 prgO parB AWT83_17880 SAP083B_019 CUM68_04720 CUN04_13020 DKP91_14980 FIU59_14555 GBM73_16965 protein protein entfc Enterococcus faecium Streptococcus faecium MALLPTNKDKKKIGAEDISIKDDINVELGERKYTAKERKPVQVDPPVLKTIRDLSYAKDIPMYEIVKLAMDAYVDTLNDEERIIYNRRSKD q9wvy4_entfc linB protein protein entfc Enterococcus faecium Streptococcus faecium MLKQKELIANVKNLTESDERITACMMYGSFTKGEGDQYSDIEFYIFLKHSITSNFDSSNWLFDVAPYLMLYKNEYGTEVVIFDNLIRGEFHFLSEKDMNIIPSFKDSGYIPDTKAMLIYDETGQLENYLSEISGARPNRLTEENANFLLCNFSNLWLMGINVLKRGEYARSLELLSQLQKNTLQLIRMAEKNADNWLNMSKNLEKEISLENYKKFAKTTARLDKVELFEAYKNSLLLVMDLQSHLIEQYNLKVTHDILERLLNYISE linb-1 3200842 N/A 3200844 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false linb-2 3200843 N/A 3200844 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false prgo-1 3167112 N/A 3167116 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false prgo-2 3167113 N/A 3167116 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false prgo-3 3167114 N/A 3167116 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false prgo-4 3167115 N/A 3167116 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false