DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lu-2013-24 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lu G., Hu Y., Wang Q., Qi J., Gao F., Li Y., Zhang Y., Zhang W., Yuan Y., Bao J., Zhang B., Shi Y., Yan J., Gao GF. Coronavirus - Interactions investigated in the context of Coronavirus DIP original experiment: DIP-255179X Nature 2013 IMEx Molecular basis of binding between novel human coronavirus MERS-CoV and its receptor CD26. Lu G., Hu Y., Wang Q., Qi J., Gao F., Li Y., Zhang Y., Zhang W., Yuan Y., Bao J., Zhang B., Shi Y., Yan J., Gao GF. Only protein-protein interactions imex curation lu-2013-25 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Lu G., Hu Y., Wang Q., Qi J., Gao F., Li Y., Zhang Y., Zhang W., Yuan Y., Bao J., Zhang B., Shi Y., Yan J., Gao GF. Coronavirus - Interactions investigated in the context of Coronavirus DIP original experiment: DIP-255177X Nature 2013 IMEx Molecular basis of binding between novel human coronavirus MERS-CoV and its receptor CD26. Lu G., Hu Y., Wang Q., Qi J., Gao F., Li Y., Zhang Y., Zhang W., Yuan Y., Bao J., Zhang B., Shi Y., Yan J., Gao GF. Only protein-protein interactions imex curation lu-2013-27 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lu G., Hu Y., Wang Q., Qi J., Gao F., Li Y., Zhang Y., Zhang W., Yuan Y., Bao J., Zhang B., Shi Y., Yan J., Gao GF. Coronavirus - Interactions investigated in the context of Coronavirus DIP original experiment: DIP-255178X Nature 2013 IMEx Molecular basis of binding between novel human coronavirus MERS-CoV and its receptor CD26. Lu G., Hu Y., Wang Q., Qi J., Gao F., Li Y., Zhang Y., Zhang W., Yuan Y., Bao J., Zhang B., Shi Y., Yan J., Gao GF. Only protein-protein interactions imex curation raj-2013-1 in vitro In vitro pull down pull down de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Raj VS., Mou H., Smits SL., Dekkers DH., Müller MA., Dijkman R., Muth D., Demmers JA., Zaki A., Fouchier RA., Thiel V., Drosten C., Rottier PJ., Osterhaus AD., Bosch BJ., Haagmans BL. Coronavirus - Interactions investigated in the context of Coronavirus DIP original experiment: DIP-252820X Nature 2013 IMEx Dipeptidyl peptidase 4 is a functional receptor for the emerging human coronavirus-EMC. Raj VS., Mou H., Smits SL., Dekkers DH., Müller MA., Dijkman R., Muth D., Demmers JA., Zaki A., Fouchier RA., Thiel V., Drosten C., Rottier PJ., Osterhaus AD., Bosch BJ., Haagmans BL. Only protein-protein interactions imex curation raj-2013-4 in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Raj VS., Mou H., Smits SL., Dekkers DH., Müller MA., Dijkman R., Muth D., Demmers JA., Zaki A., Fouchier RA., Thiel V., Drosten C., Rottier PJ., Osterhaus AD., Bosch BJ., Haagmans BL. Coronavirus - Interactions investigated in the context of Coronavirus DIP original experiment: DIP-252821X Nature 2013 IMEx Dipeptidyl peptidase 4 is a functional receptor for the emerging human coronavirus-EMC. Raj VS., Mou H., Smits SL., Dekkers DH., Müller MA., Dijkman R., Muth D., Demmers JA., Zaki A., Fouchier RA., Thiel V., Drosten C., Rottier PJ., Osterhaus AD., Bosch BJ., Haagmans BL. Only protein-protein interactions imex curation raj-2013-5 human Homo sapiens Human comigration in sds comigration in sds page comigration in sds weight by staining molecular weight estimation by staining weight by staining Raj VS., Mou H., Smits SL., Dekkers DH., Müller MA., Dijkman R., Muth D., Demmers JA., Zaki A., Fouchier RA., Thiel V., Drosten C., Rottier PJ., Osterhaus AD., Bosch BJ., Haagmans BL. Coronavirus - Interactions investigated in the context of Coronavirus DIP original experiment: DIP-252823X Nature 2013 IMEx Dipeptidyl peptidase 4 is a functional receptor for the emerging human coronavirus-EMC. Raj VS., Mou H., Smits SL., Dekkers DH., Müller MA., Dijkman R., Muth D., Demmers JA., Zaki A., Fouchier RA., Thiel V., Drosten C., Rottier PJ., Osterhaus AD., Bosch BJ., Haagmans BL. Only protein-protein interactions imex curation k0brg7_mers Spike glycoprotein E2 Peplomer protein S protein protein cv2ce Human betacoronavirus 2c EMC/2012 MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTWPRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFVANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGKMGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGNYNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGGNMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIRRAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVGVRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHISSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPDTPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTTIQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSSQSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQQGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPFAQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFQKVQDAVNNNAQALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVRSESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNHIEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKYVAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCCTGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH dpp4_human Dipeptidyl peptidase 4 DPP4 ADCP2 CD26 ADABP Adenosine deaminase complexing protein 2 Dipeptidyl peptidase IV T-cell activation antigen CD26 TP103 protein protein human Homo sapiens Human MKTPWKVLLGLLGAAALVTIITVPVVLLNKGTDDATADSRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYLCDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHSSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKYPLLLDVYAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP s-dpp4-3 3255496 N/A 3255500 unspecified role unspecified role prey prey Region 39-766 Region 39-766 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3255501 unspecified role unspecified role bait bait Region 367-606 Region 367-606 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false dpp4-s-1 3255497 N/A 3255500 unspecified role unspecified role unspecified role unspecified role Region 39-766 Region 39-766 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3255501 unspecified role unspecified role unspecified role unspecified role Region 367-606 Region 367-606 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false dpp4-s-2 3255499 N/A 3255500 unspecified role unspecified role unspecified role unspecified role Region 39-766 Region 39-766 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3255501 unspecified role unspecified role unspecified role unspecified role Region 367-606 Region 367-606 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false s-dpp4-1 3251840 N/A 3255500 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3255501 unspecified role unspecified role bait bait S1 domain Region 1-747 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Fc-tag Fc-tag fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false s-dpp4-2 3251843 N/A 3255500 unspecified role unspecified role prey prey Region 39-766 Region 39-766 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3255501 unspecified role unspecified role bait bait S1 domain Region 1-747 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Fc-tag Fc-tag fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human direct interaction direct interaction false false false s-10 3251844 N/A 3255501 unspecified role unspecified role unspecified role unspecified role S1 domain Region 1-747 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Fc-tag Fc-tag fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human covalent binding covalent binding false false false IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ aouadi-2017-3 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined Aouadi W., Blanjoie A., Vasseur JJ., Debart F., Canard B., Decroly E. Virus - Publications including interactions involving viral proteins etienne.decroly@afmb.univ-mrs.fr Journal of Virology 2017 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus aouadi-2017-1 in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom weight by comassie molecular weight estimation by coomasie staining weight by comassie Aouadi W., Blanjoie A., Vasseur JJ., Debart F., Canard B., Decroly E. Virus - Publications including interactions involving viral proteins etienne.decroly@afmb.univ-mrs.fr Journal of Virology 2017 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus aouadi-2017-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Aouadi W., Blanjoie A., Vasseur JJ., Debart F., Canard B., Decroly E. Virus - Publications including interactions involving viral proteins etienne.decroly@afmb.univ-mrs.fr Journal of Virology 2017 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus wang-2021-19 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es mBio 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus wang-2021-18 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es mBio 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus wang-2021-17 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es mBio 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus wang-2021-20 human-mrc5 Human foetal lung fibroblast-like cell line mrc5 Human foetal lung fibroblast-like cell line confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es mBio 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus wang-2021-21 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma rna-ip rna immunoprecipitation rna-ip qrt-pcr quantitative reverse transcription pcr QRT-PCR Wang L., Sola I., Enjuanes L., Zuñiga S. Virus - Publications including interactions involving viral proteins RNA-IP; No cross linking was carried out prior to IP. This publication uses "Mouse-adapted MERS-CoV" (see Ref.16-PMID: 33144319) with accession no: JX869059 which has an N30K mutation in the N protein. This accession number corresponds to Trembl entry K0BVN3 for the N protein. L.Enjuanes@cnb.csic.es,szuniga@cnb.csic.es mBio 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus chu-2018-2 mesau-bhk21 Mesocricetus auratus_BHK21 bhk-21 Cells from kidneys of five unsexed, one-day-old hamsters BHK-21/C13 cell anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chu H., Chan CM., Zhang X., Wang Y., Yuan S., Zhou J., Au-Yeung RK., Sze KH., Yang D., Shuai H., Hou Y., Li C., Zhao X., Poon VK., Leung SP., Yeung ML., Yan J., Lu G., Jin DY., Gao GF., Chan JF., Yuen KY., Chu H., Chan CM., Zhang X., Wang Y., Yuan S., Zhou J., Au-Yeung RK., Sze KH., Yang D., Shuai H., Hou Y., Li C., Zhao X., Poon VK., Leung SP., Yeung ML., Yan J., Lu G., Jin DY., Gao GF., Chan JF., Yuen KY. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus bCoV-HKU9 spike glycoprotein Uniprot accession was taken from back referenced 27696819 The range of S1 in spike glycoprotein and its tag features were annotated from back referenced 27489282 The viral strain was provided by Ron Fouchier, which is Human betacoronavirus 2c EMC/2012 isolate, with GenBank accession number, JX869059 (from PMID 23075143); S glycoprotein accession was chosen based on AFS88936.1 id provided in the GenBank submission kyyuen@hku.hk,jfwchan@hku.hk The Journal of biological chemistry 2018 Only protein-protein interactions imex curation imex curation chu-2018-5 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chu H., Chan CM., Zhang X., Wang Y., Yuan S., Zhou J., Au-Yeung RK., Sze KH., Yang D., Shuai H., Hou Y., Li C., Zhao X., Poon VK., Leung SP., Yeung ML., Yan J., Lu G., Jin DY., Gao GF., Chan JF., Yuen KY., Chu H., Chan CM., Zhang X., Wang Y., Yuan S., Zhou J., Au-Yeung RK., Sze KH., Yang D., Shuai H., Hou Y., Li C., Zhao X., Poon VK., Leung SP., Yeung ML., Yan J., Lu G., Jin DY., Gao GF., Chan JF., Yuen KY. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus The range of S1 in spike glycoprotein and its tag features were annotated from back referenced 27489282 The viral strain was provided by Ron Fouchier, which is Human betacoronavirus 2c EMC/2012 isolate, with GenBank accession number, JX869059 (from PMID 23075143); S glycoprotein accession was chosen based on AFS88936.1 id provided in the GenBank submission kyyuen@hku.hk,jfwchan@hku.hk The Journal of biological chemistry 2018 Only protein-protein interactions imex curation imex curation chu-2018-6 human-beas_2b Human bronchial epithelial cell line BEAS-2B beas_2b Human bronchial epithelial cell line BEAS-2B http://cancerres.aacrjournals.org/cgi/content/abstract/48/7/1904?ijkey=330aa4101c1c77d6fbc2b1fc3d60b4ead4af2511&keytype2=tf_ipsecsha anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chu H., Chan CM., Zhang X., Wang Y., Yuan S., Zhou J., Au-Yeung RK., Sze KH., Yang D., Shuai H., Hou Y., Li C., Zhao X., Poon VK., Leung SP., Yeung ML., Yan J., Lu G., Jin DY., Gao GF., Chan JF., Yuen KY., Chu H., Chan CM., Zhang X., Wang Y., Yuan S., Zhou J., Au-Yeung RK., Sze KH., Yang D., Shuai H., Hou Y., Li C., Zhao X., Poon VK., Leung SP., Yeung ML., Yan J., Lu G., Jin DY., Gao GF., Chan JF., Yuen KY. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus The range of S1 in spike glycoprotein and its tag features were annotated from back referenced 27489282 The viral strain was provided by Ron Fouchier, which is Human betacoronavirus 2c EMC/2012 isolate, with GenBank accession number, JX869059 (from PMID 23075143); S glycoprotein accession was chosen based on AFS88936.1 id provided in the GenBank submission kyyuen@hku.hk,jfwchan@hku.hk The Journal of biological chemistry 2018 Only protein-protein interactions imex curation imex curation chu-2018-1 human-beas_2b Human bronchial epithelial cell line BEAS-2B beas_2b Human bronchial epithelial cell line BEAS-2B http://cancerres.aacrjournals.org/cgi/content/abstract/48/7/1904?ijkey=330aa4101c1c77d6fbc2b1fc3d60b4ead4af2511&keytype2=tf_ipsecsha anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Chu H., Chan CM., Zhang X., Wang Y., Yuan S., Zhou J., Au-Yeung RK., Sze KH., Yang D., Shuai H., Hou Y., Li C., Zhao X., Poon VK., Leung SP., Yeung ML., Yan J., Lu G., Jin DY., Gao GF., Chan JF., Yuen KY., Chu H., Chan CM., Zhang X., Wang Y., Yuan S., Zhou J., Au-Yeung RK., Sze KH., Yang D., Shuai H., Hou Y., Li C., Zhao X., Poon VK., Leung SP., Yeung ML., Yan J., Lu G., Jin DY., Gao GF., Chan JF., Yuen KY. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus The range of S1 in spike glycoprotein and its tag features were annotated from back referenced 27489282 The viral strain was provided by Ron Fouchier, which is Human betacoronavirus 2c EMC/2012 isolate, with GenBank accession number, JX869059 (from PMID 23075143); S glycoprotein accession was chosen based on AFS88936.1 id provided in the GenBank submission kyyuen@hku.hk,jfwchan@hku.hk The Journal of biological chemistry 2018 Only protein-protein interactions imex curation imex curation chu-2018-3 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chu H., Chan CM., Zhang X., Wang Y., Yuan S., Zhou J., Au-Yeung RK., Sze KH., Yang D., Shuai H., Hou Y., Li C., Zhao X., Poon VK., Leung SP., Yeung ML., Yan J., Lu G., Jin DY., Gao GF., Chan JF., Yuen KY., Chu H., Chan CM., Zhang X., Wang Y., Yuan S., Zhou J., Au-Yeung RK., Sze KH., Yang D., Shuai H., Hou Y., Li C., Zhao X., Poon VK., Leung SP., Yeung ML., Yan J., Lu G., Jin DY., Gao GF., Chan JF., Yuen KY. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus The range of S1 in spike glycoprotein and its tag features were annotated from back referenced 27489282 The viral strain was provided by Ron Fouchier, which is Human betacoronavirus 2c EMC/2012 isolate, with GenBank accession number, JX869059 (from PMID 23075143); S glycoprotein accession was chosen based on AFS88936.1 id provided in the GenBank submission kyyuen@hku.hk,jfwchan@hku.hk The Journal of biological chemistry 2018 Only protein-protein interactions imex curation imex curation chu-2018-4 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Chu H., Chan CM., Zhang X., Wang Y., Yuan S., Zhou J., Au-Yeung RK., Sze KH., Yang D., Shuai H., Hou Y., Li C., Zhao X., Poon VK., Leung SP., Yeung ML., Yan J., Lu G., Jin DY., Gao GF., Chan JF., Yuen KY., Chu H., Chan CM., Zhang X., Wang Y., Yuan S., Zhou J., Au-Yeung RK., Sze KH., Yang D., Shuai H., Hou Y., Li C., Zhao X., Poon VK., Leung SP., Yeung ML., Yan J., Lu G., Jin DY., Gao GF., Chan JF., Yuen KY. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus The range of S1 in spike glycoprotein and its tag features were annotated from back referenced 27489282 The viral strain was provided by Ron Fouchier, which is Human betacoronavirus 2c EMC/2012 isolate, with GenBank accession number, JX869059 (from PMID 23075143); S glycoprotein accession was chosen based on AFS88936.1 id provided in the GenBank submission kyyuen@hku.hk,jfwchan@hku.hk The Journal of biological chemistry 2018 Only protein-protein interactions imex curation imex curation daczkowski-2017-4 in vitro In vitro protease assay protease assay western blot western blot Immuno blot Immuno blot Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD., Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD. Virus - Publications including interactions involving viral proteins spegan@uga.edu Journal of virology 2017 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus daczkowski-2017-1 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD., Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD. Virus - Publications including interactions involving viral proteins C-terminal range of ISG15 has been captured from 5tl6 crystal deposited in pdbe (28438633) spegan@uga.edu Journal of virology 2017 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus daczkowski-2017-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD., Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD. Virus - Publications including interactions involving viral proteins spegan@uga.edu Journal of virology 2017 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus daczkowski-2017-3 in vitro In vitro protease assay protease assay tag fluorescence tag visualisation by fluorescence tag fluorescence Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD., Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD. Virus - Publications including interactions involving viral proteins The substrate is labelled with 7-Amino-4-methylcoumarin (AMC), a fluorescent probe for peptide labeling commonly used in the study of proteases. Conjugation of AMC via its amino group to a peptide substrate results in quenching of the fluorescent signal. Upon enzymatic cleavage of the peptide by proteases, AMC is released and its fluorescence can be used to quantify enzyme activity. spegan@uga.edu Journal of virology 2017 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus chan-2016-2 mesau-bhk21 Mesocricetus auratus_BHK21 bhk-21 Cells from kidneys of five unsexed, one-day-old hamsters BHK-21/C13 cell anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chan CM., Chu H., Wang Y., Wong BH., Zhao X., Zhou J., Yang D., Leung SP., Chan JF., Yeung ML., Yan J., Lu G., Gao GF., Yuen KY. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus The viral strain was provided by Ron Fouchier, which is Human betacoronavirus 2c EMC/2012 isolate, with GenBank accession number, JX869059 (from PMID 23075143); S glycoprotein accession was chosen based on AFS88936.1 id provided in the GenBank submission kyyuen@hku.hk Journal of virology 2016 Only protein-protein interactions imex curation imex curation chan-2016-3 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chan CM., Chu H., Wang Y., Wong BH., Zhao X., Zhou J., Yang D., Leung SP., Chan JF., Yeung ML., Yan J., Lu G., Gao GF., Yuen KY. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus The viral strain was provided by Ron Fouchier, which is Human betacoronavirus 2c EMC/2012 isolate, with GenBank accession number, JX869059 (from PMID 23075143); S glycoprotein accession was chosen based on AFS88936.1 id provided in the GenBank submission kyyuen@hku.hk Journal of virology 2016 Only protein-protein interactions imex curation imex curation chan-2016-1 in vitro In vitro pull down pull down sequence tag sequence tag identification sequence tag Chan CM., Chu H., Wang Y., Wong BH., Zhao X., Zhou J., Yang D., Leung SP., Chan JF., Yeung ML., Yan J., Lu G., Gao GF., Yuen KY. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus The viral strain was provided by Ron Fouchier, which is Human betacoronavirus 2c EMC/2012 isolate, with GenBank accession number, JX869059 (from PMID 23075143); S glycoprotein accession was chosen based on AFS88936.1 id provided in the GenBank submission kyyuen@hku.hk Journal of virology 2016 Only protein-protein interactions imex curation imex curation k0bwd0_mers 2'-O-methyltransferase orf1ab 3C-like proteinase Growth factor-like peptide Guanine-N7 methyltransferase Helicase Host translation inhibitor nsp1 Leader protein NendoU Non-structural protein 10 Non-structural protein 2 Non-structural protein 3 Non-structural protein 4 Non-structural protein 6 Non-structural protein 7 Non-structural protein 8 Non-structural protein 9 ORF1ab polyprotein Papain-like proteinase RNA-directed RNA polymerase Replicase polyprotein 1ab Uridylate-specific endoribonuclease nsp5 p65 homolog nsp12 nsp14 nsp15 nsp13 nsp16 protein protein cv2ce Human betacoronavirus 2c EMC/2012 MSFVAGVTAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEKLSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFMVNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHYERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMAKDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQKDGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSAFIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGDSCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSVVSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVDKIRQLLKGVTLDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLGESFKKVATIPYKVCNSVKDTLAYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVASTYFLVRILQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRNAYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSKIIAVIYSGRESLIFPSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVGQLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPVKKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKEQVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSEVEASDLEEGESECISETSTEQVDVSHETSDDEWAAAVDEAFPLDEAEDVTESVQEEAQPVEVPVEDIAQVVIADTLQETPVVPDTVEVPPQVVKLPSAPQTIQPEVKEVAPVYEADTEQTQNVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAANTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVGPDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVVNSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVDYTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLMQAGSVVRRVNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRLNKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSPATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDVLLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKFTPLSVESTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVADDSGTPVVEYLSKEDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFYFKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFAKMLFMLPLAYFSDSKLGTTEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSSVYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFCANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFNWLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRKFYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCVDCDTAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQPFYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVLCKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRGDNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKPDSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNLAFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNALRDFTLKGYVLATIIVFLCAVLMYLCLPTFSMAPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGVYDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEIPYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNMFIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVYCGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQCAVIAVVAAVLNSLCICFVTSIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGPIVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTYAALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLYQPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQATKFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEPTTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALALCSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLTLVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNLTAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSRAWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQATLSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKLERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPLSVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDSNENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQGRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNNLHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNCVKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQIPAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQAALPQSKDSNFLNRVRGSIVNARIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVKRHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYALRHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTVKFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMTDCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRCVLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRHRLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDFVVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYFEIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPTMTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYGGWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYRLANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANGNKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDYAAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYFLPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQYIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQTSLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSYFCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTEPLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYHITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQERYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTARVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTINALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLEPENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILYKGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVSRSMLGLTTQTVDSSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSFTNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANVPYSRVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLGFSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQMLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYACWTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHSCFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVDDPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTRVHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIEDIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNLWSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLPTNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDIDVNSALNICFDIRDNCSLEKFMSTPNAIFISDRKIKKYPCMVGPDYAYFNGAIIRDSDVVKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGLENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNTAAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYPRLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLNTCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFGDCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTDVLVNTYRKLR bip_human Endoplasmic reticulum chaperone BiP HSPA5 GRP78 Immunoglobulin heavy chain-binding protein 78 kDa glucose-regulated protein Binding-immunoglobulin protein Heat shock protein 70 family protein 5 Heat shock protein family A member 5 protein protein human Homo sapiens Human MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL k0brg7_mers Spike glycoprotein E2 Peplomer protein S protein protein cv2ce Human betacoronavirus 2c EMC/2012 MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTWPRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFVANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGKMGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGNYNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGGNMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIRRAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVGVRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHISSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPDTPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTTIQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSSQSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQQGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPFAQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFQKVQDAVNNNAQALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVRSESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNHIEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKYVAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCCTGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH a3exg6-pro_0000291369 Spike protein S1 S E2 Peplomer protein 2 protein protein BtCoV-2 Bat coronavirus HKU9 BtCoV/HKU9 AAASRPECFNPRFTLTPLNHTLNYTSIKAKVSNVLLPDPYIAYSGQTLRQNLFMADMSNTILYPVTPPANGANGGFIYNTSIIPVSAGLFVNTWMYRQPASSRAYCQEPFGVAFGDTFENDRIAILIMAPDNLGSWSAVAPRNQTNIYLLVCSNATLCINPGFNRWGPAGSFIAPDALVDHSNSCFVNNTFSVNISTSRISLAFLFKDGDLLIYHSGWLPTSNFEHGFSRGSHPMTYFMSLPVGGNLPRAQFFQSIVRSNAIDKGDGMCTNFDVNLHVAHLINRDLLVSYFNNGSVANAADCADSAAEELYCVTGSFDPPTGVYPLSRYRAQVAGFVRVTQRGSYCTPPYSVLQDPPQPVVWRRYMLYDCVFDFTVVVDSLPTHQLQCYGVSPRRLASMCYGSVTLDVMRINETHLNNLFNRVPDTFSLYNYALPDNFYGCLHAFYLNSTAPYAVANRFPIKPGGRQSNSAFIDTVINAAHYSPFSYVYGLAVITLKPAAGSKLVCPVANDTVVITDRCVQYNLYGYTGTGVLSKNTSLVIPDGKVFTASSTGTIIGVSINSTTYSIMPCVTVPVSVGYHPNFERALLFNGLSCSQRSRAVTEPVSVLWSASATAQDAFDTPSGCVVNVELRNTTIVNTCAMPIGNSLCFINGSIATANADSLPR 12 676 ceam5_human Carcinoembryonic antigen-related cell adhesion molecule 5 CEACAM5 CEA Carcinoembryonic antigen Meconium antigen 100 protein protein human Homo sapiens Human MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI p06731-1 Carcinoembryonic antigen-related cell adhesion molecule 5 Carcinoembryonic antigen Meconium antigen 100 CEACAM5 CEA protein protein human Homo sapiens Human MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI ncap_cvh22 Nucleoprotein N Nucleocapsid protein 7 protein protein hcov-229e Human coronavirus 229E HCoV-229E MATVKWADASEPQRGRQGRIPYSLYSPLLVDSEQPWKVIPRNLVPINKKDKNKLIGYWNVQKRFRTRKGKRVDLSPKLHFYYLGTGPHKDAKFRERVEGVVWVAVDGAKTEPTGYGVRRKNSEPEIPHFNQKLPNGVTVVEEPDSRAPSRSQSRSQSRGRGESKPQSRNPSSDRNHNSQDDIMKAVAAALKSLGFDKPQEKDKKSAKTGTPKPSRNQSPASSQTSAKSLARSQSSETKEQKHEMQKPRWKRQPNDDVTSNVTQCFGPRDLDHNFGSAGVVANGVKAKGYPQFAELVPSTAAMLFDSHIVSKESGNTVVLTFTTRVTVPKDHPHLGKFLEELNAFTREMQQHPLLNPSALEFNPSQTSPATAEPVRDEVSIETDIIDEVN mint homomint g-rna human betacoronavirus 2c emc/2012 rna ribonucleic acid RNA rna cv2ce Human betacoronavirus 2c EMC/2012 ago2_human Protein argonaute-2 AGO2 Argonaute RISC catalytic component 2 EIF2C2 Eukaryotic translation initiation factor 2C 2 PAZ Piwi domain protein Protein slicer protein protein human Homo sapiens Human MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQALAKAVQVHQDTLRTMYFA rent1_human Regulator of nonsense transcripts 1 UPF1 RENT1 KIAA0221 ATP-dependent helicase RENT1 Nonsense mRNA reducing factor 1 Up-frameshift suppressor 1 homolog protein protein human Homo sapiens Human MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGPGGGGAGGPGGAGAGAAAGQLDAQVGPEGILQNGAVDDSVAKTSQLLAELNFEEDEEDTYYTKDLPIHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLGETVLECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSGNEDLVIIWLRDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLNYYKEQKVLVEGPLNNLRESLMQFSKPRKLVNTINPGARFMTTAMYDAREAIIPGSVYDRSSQGRPSSMYFQTHDQIGMISAGPSHVAAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQPGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLSQY mov10_human Helicase MOV-10 Moloney leukemia virus 10 protein MOV10 KIAA1631 Armitage homolog protein protein human Homo sapiens Human MPSKFSCRQLREAGQCFESFLVVRGLDMETDRERLRTIYNRDFKISFGTPAPGFSSMLYGMKIANLAYVTKTRVRFFRLDRWADVRFPEKRRMKLGSDISKHHKSLLAKIFYDRAEYLHGKHGVDVEVQGPHEARDGQLLIRLDLNRKEVLTLRLRNGGTQSVTLTHLFPLCRTPQFAFYNEDQELPCPLGPGECYELHVHCKTSFVGYFPATVLWELLGPGESGSEGAGTFYIARFLAAVAHSPLAAQLKPMTPFKRTRITGNPVVTNRIEEGERPDRAKGYDLELSMALGTYYPPPRLRQLLPMLLQGTSIFTAPKEIAEIKAQLETALKWRNYEVKLRLLLHLEELQMEHDIRHYDLESVPMTWDPVDQNPRLLTLEVPGVTESRPSVLRGDHLFALLSSETHQEDPITYKGFVHKVELDRVKLSFSMSLLSRFVDGLTFKVNFTFNRQPLRVQHRALELTGRWLLWPMLFPVAPRDVPLLPSDVKLKLYDRSLESNPEQLQAMRHIVTGTTRPAPYIIFGPPGTGKTVTLVEAIKQVVKHLPKAHILACAPSNSGADLLCQRLRVHLPSSIYRLLAPSRDIRMVPEDIKPCCNWDAKKGEYVFPAKKKLQEYRVLITTLITAGRLVSAQFPIDHFTHIFIDEAGHCMEPESLVAIAGLMEVKETGDPGGQLVLAGDPRQLGPVLRSPLTQKHGLGYSLLERLLTYNSLYKKGPDGYDPQFITKLLRNYRSHPTILDIPNQLYYEGELQACADVVDRERFCRWAGLPRQGFPIIFHGVMGKDEREGNSPSFFNPEEAATVTSYLKLLLAPSSKKGKARLSPRSVGVISPYRKQVEKIRYCITKLDRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSSQSFVQLDLDFNLGFLKNPKRFNVAVTRAKALLIIVGNPLLLGHDPDWKVFLEFCKENGGYTGCPFPAKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWRNEL k0bvn3_mers Nucleoprotein N Nucleocapsid protein protein protein cv2ce Human betacoronavirus 2c EMC/2012 MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWYTGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYYTGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNFHIEGTGGNSQSSSRASSLSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDLLNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQGNFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGAIKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSITQRTRTRPSVQPGPMIDVNTD tiar_human Nucleolysin TIAR TIAL1 TIA-1-related protein protein protein human Homo sapiens Human MMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ isg15_human Ubiquitin-like protein ISG15 ISG15 G1P2 UCRP Interferon-induced 15 kDa protein Interferon-induced 17 kDa protein Ubiquitin cross-reactive protein protein protein human Homo sapiens Human MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS r9qb93_tupbe protein protein Common tree shrew Tupaia belangeri Tupaia glis belangeri MGRDLKVKMLGGQEFMVPISDSMLAMELKQKITKKIGVPAFQQRLAIHPSGTVLQDRVPLGHQGLDSDSIVLLVVQSCDSPLNILVRNNKGRSSSYEVRLTQTVAHLKQLVSQQEGVQADLFWLSYEGRDMEDQKPLGEYGLMSQSTVYMHLRLRGG orf1ab-orf1ab-6 3711696 N/A 3711699 unspecified role unspecified role prey prey purified purified nsp16 sufficient to bind sufficient binding region sufficient to bind range range range range false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3711699 unspecified role unspecified role bait bait purified purified nsp10 sufficient to bind sufficient binding region sufficient to bind range range range range false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 3711696 3711696 3711696 Fig. 6a, Table 2 orf1ab-orf1ab-7 3711696 N/A 3711699 unspecified role unspecified role prey prey purified purified nsp16 sufficient to bind sufficient binding region sufficient to bind range range range range false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3711699 unspecified role unspecified role bait bait purified purified nsp10 sufficient to bind sufficient binding region sufficient to bind range range range range false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 3711696 3711696 3711696 Fig. 6b, Table 2 orf1ab-orf1ab-8 3711696 N/A 3711699 unspecified role unspecified role prey prey purified purified nsp16 sufficient to bind sufficient binding region sufficient to bind range range range range false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3711699 unspecified role unspecified role bait bait purified purified nsp10 sufficient to bind sufficient binding region sufficient to bind range range range range false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 3711696 3711696 3711696 Fig. 6b, Table 2 orf1ab-orf1ab-9 3711696 N/A 3711699 unspecified role unspecified role prey prey purified purified nsp16 sufficient to bind sufficient binding region sufficient to bind range range range range false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3711699 unspecified role unspecified role bait bait purified purified nsp10 sufficient to bind sufficient binding region sufficient to bind range range range range false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false 3711696 3711696 3711696 Fig. 6b, Table 2 orf1ab-orf1ab-4 3711697 N/A 3711699 unspecified role unspecified role neutral component neutral component purified purified nsp16 sufficient to bind sufficient binding region sufficient to bind range range range range false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 3711699 unspecified role unspecified role neutral component neutral component purified purified nsp10 sufficient to bind sufficient binding region sufficient to bind range range range range false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 1a orf1ab-orf1ab-5 3711698 N/A 3711699 unspecified role unspecified role neutral component neutral component purified purified nsp16 sufficient to bind sufficient binding region sufficient to bind range range range range false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 3711699 unspecified role unspecified role neutral component neutral component purified purified nsp10 sufficient to bind sufficient binding region sufficient to bind range range range range false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 1b tial1-mov10-2 4086420 N/A 4086427 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086428 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086429 unspecified role unspecified role prey prey infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain false association association false false false 2D tial1-mov10-1 4086420 N/A 4086427 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086428 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 2D Weak interaction. The text states:-"Endogenous MOV10 protein interaction in mock-infected cells was detected only for TIAR." ago2-mov10-1 4086420 N/A 4086430 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086428 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086429 unspecified role unspecified role prey prey infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain false association association false false false 2D upf1-mov10-1 4086420 N/A 4086431 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086428 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086429 unspecified role unspecified role prey prey infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain false association association false false false 2D ago2-mov10-2 4086420 N/A 4086430 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086429 unspecified role unspecified role prey prey infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain false association association false false false 6D This interaction was seen in MOV10-KO cells. mov10-n-2 4086421 N/A 4086428 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Q9HCE1:p.[Lys530Ala;Asp645Asn] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 4086429 unspecified role unspecified role prey prey infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2 A/B, 7D RNAse The interaction of N protein with MOV10 was RNA dependant. mov10-n-6 4086421 N/A 4086432 unspecified role unspecified role prey prey infection infection N/A 4086428 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 8A The interaction of Mers N protein with MOV10 was RNA dependant, so it has been assumed the MOV10 interaction with other coronavirus N proteins may also be. mov10-n-1 4086422 N/A 4086428 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086429 unspecified role unspecified role neutral component neutral component infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 1A MOV10 extensively colocalized with MERS-CoV N protein in the cytoplasm, mainly in the larger granules. mov10-n-3 4086423 N/A 4086428 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4086429 unspecified role unspecified role neutral component neutral component infection infection K0BVN3:p.Asn30Lys mutation mutation certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false Supp. figure 1 MOV10 extensively colocalized with MERS-CoV N protein in the cytoplasm, mainly in the larger granules. mov10-to set_4-1 4086424 N/A 4086433 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N protein mRNA sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 4086428 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 5 hspa5-s-2 3679490 N/A 3679496 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3679497 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed electroporation electroporation s1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 2a s-hspa5-1 3679490 N/A 3679496 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3679497 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed electroporation electroporation s1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 2b hspa5-s-6 3679490 N/A 3679496 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3679498 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed electroporation electroporation c-terminal region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 8a hspa5-s-3 3679491 N/A 3679496 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3679497 unspecified role unspecified role prey prey infection infection physical association physical association false false false 2e hspa5-s-4 3679491 N/A 3679496 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3679497 unspecified role unspecified role bait bait infection infection physical association physical association false false false 2e hspa5-s-5 3679492 N/A 3679496 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3679497 unspecified role unspecified role prey prey infection infection physical association physical association false false false 2e s-hspa5-4 3679492 N/A 3679497 unspecified role unspecified role bait bait infection infection N/A 3679496 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 2e hspa5-s-1 3679493 N/A 3679496 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3679497 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false s1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig 1c-e s-hspa5-2 3679494 N/A 3679496 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3679497 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed s1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 2c s-hspa5-3 3679495 N/A 3679496 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3679497 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed s1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 2d isg15-orf1ab-4 3709757 N/A 3711699 enzyme enzyme neutral component neutral component purified purified K0BWD0:p.Lys1657Glu mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain false K0BWD0:p.Val1691Asp mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain false protease domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3709762 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) protein cleavage protein cleavage false false false 3709757 Fig. 8A Papain-like protease domain range was inferred from the sequence provided in Fig. 1 isg15-orf1ab-6 3709757 N/A 3709763 enzyme target enzyme target substrate substrate neutral component neutral component purified purified R9QB93:p.Ser144Pro mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain false R9QB93:p.Gln145Leu mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain false pro-ISG15 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3711699 enzyme enzyme neutral component neutral component purified purified protease domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) protein cleavage protein cleavage false false false Fig. 5c isg15-orf1ab-1 3709758 N/A 3711699 unspecified role unspecified role neutral component neutral component purified purified K0BWD0:p.Lys1657Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false K0BWD0:p.Val1691Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false protease domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3709762 unspecified role unspecified role neutral component neutral component purified purified c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3709758 Table 1, Fig. 2a Papain-like protease domain range was inferred from the sequence provided in Fig. 1 isg15-orf1ab-2 3709759 N/A 3709762 unspecified role unspecified role neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3711699 unspecified role unspecified role neutral component neutral component purified purified protease domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Table 2 2.41Å Rwork: 0.212 Rfree: 0.237 isg15-orf1ab-3 3709760 N/A 3711699 enzyme enzyme neutral component neutral component purified purified K0BWD0:p.Lys1547Ala mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain false K0BWD0:p.Glu1551Ala mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain false K0BWD0:p.Lys1608Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false K0BWD0:p.Glu1659Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false K0BWD0:p.Glu1659Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false K0BWD0:p.Gln1683Ala mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain false K0BWD0:p.Lys1657Leu mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain false K0BWD0:p.Lys1657Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain false K0BWD0:p.Val1706Pro mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain false K0BWD0:p.Val1706Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false K0BWD0:p.Val1706Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false K0BWD0:p.Gln1708Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false K0BWD0:p.Arg1713Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false K0BWD0:p.Arg1713Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain false K0BWD0:p.Lys1657Glu mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain false K0BWD0:p.Val1691Asp mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain false protease domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false K0BWD0:p.Arg1715Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain false N/A 3709762 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminus fluorophore fluorophore c-term range C-terminal range c-term range c-term range C-terminal range c-term range false protein cleavage protein cleavage false false false 3709760 3709760 3709760 Figs. 6b, 7b, Table 3 Papain-like protease domain range was inferred from the sequence provided in Fig. 1 ceacam5-s-2 3680430 N/A 3680433 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3679497 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminal region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false s1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 4b ceacam5-s-3 3680430 N/A 3679497 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false s1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3680433 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminal region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 4a ceacam5-s-4 3680431 N/A 3680433 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3679497 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level infection infection physical association physical association false false false 4d ceacam5-s-5 3680431 N/A 3680433 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3679497 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level infection infection physical association physical association false false false 4d ceacam5-s-1 3680432 N/A 3680435 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma N/A 3679497 unspecified role unspecified role bait bait infection infection native native cv2ce Human betacoronavirus 2c EMC/2012 physical association physical association false false false Fig. 1