DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ alejo-2006-23 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262800X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions imex curation alejo-2006-24 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262801X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions imex curation alejo-2006-28 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. DIP original experiment: DIP-262802X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A chemokine-binding domain in the tumor necrosis factor receptor from variola (smallpox) virus. Alejo A., Ruiz-Argüello MB., Ho Y., Smith VP., Saraiva M., Alcami A. Only protein-protein interactions imex curation ccl25_mouse C-C motif chemokine 25 Ccl25 Scya25 Teck Small-inducible cytokine A25 Thymus-expressed chemokine Chemokine TECK protein protein mouse Mus musculus Mouse MKLWLFACLVACFVGAWMPVVHAQGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAMRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN mint Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9 q8qmn0_cwpxb CPXV218 CDS protein protein cpv Cowpox virus (strain Brighton Red) MMIYGLIACLIFVTSSTASPLYIPVIPPITEDKSFNSVEVLVSLFRDEQKDYTVTSQFNNYTIDTKDWTINVLSTPDGLEIPLTNITYWSRFPTIGHALFKSESEDIFQKNMSILGVSIECKKPSTSFTFLTVRKISRVFNRFPDMAYYRGDCLEVVYVTMTYKNTKTGETDYTYLSNVGIPEYYRLMSGVDG cxl13_mouse C-X-C motif chemokine 13 Cxcl13 Blc Scyb13 Small-inducible cytokine B13 B lymphocyte chemoattractant CXC chemokine BLC protein protein mouse Mus musculus Mouse MRLSTATLLLLLASCLSPGHGILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA mint Strongly chemotactic for B-lymphocytes, weakly for spleen monocytes and macrophages but no chemotactic activity for granulocytes. Binds to BLR1/CXCR5. May play a role in directing the migration of B-lymphocytes to follicles in secondary lymphoid organs sdf1_mouse Stromal cell-derived factor 1 Cxcl12 Sdf1 12-O-tetradecanoylphorbol 13-acetate repressed protein 1 C-X-C motif chemokine 12 Pre-B cell growth-stimulating factor Thymic lymphoma cell-stimulating factor protein protein mouse Mus musculus Mouse MDAKVVAVLALVLAALCISDGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM cpxv218 cds-ccl25-1 3143093 N/A 3143103 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3143117 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false cpxv218 cds-cxcl13-1 3143094 N/A 3143107 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3143117 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false cpxv218 cds-cxcl12-1 3143098 N/A 3143106 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3143117 unspecified role unspecified role bait bait trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint renatus-2000-1 Crystal structure of the apoptotic suppressor CrmA in its cleaved form. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Renatus M., Zhou Q., Stennicke HR., Snipas SJ., Turk D., Bankston LA., Liddington RC., Salvesen GS. Virus - Publications including interactions involving viral proteins Structure (0969-2126) 2000 spi2_var67 Serine proteinase inhibitor 2 SPI-2 B13R B12R B14R protein protein varv Variola virus (isolate Human/India/Ind3/1967) VARV Smallpox virus MDIFREIASSTKGENVFISPATISSVLTILYYGANGSTAEQLSKYVEKEETMDKVSAQNISFKSMNKVYGRYSAVFKNSFLGKIGDNFQTVDFTDCRTIDAINKCVDVFTEGKINPLLTEQLSPNTCLLAISAVYFKAKWLIPFKKEFTSDYPFYVSPTEMVDVSMMSMYGESFNYASVKESFGNFSIIELPYVGNTSMMVILPDKIDGLESIKQNLTDTNFKKWCNSLEATFIDVHIPKFKVTGSYNLVDTLVKLGLTDVFYSTGDYSNMCNSDVSVDAMIHKTYIDVNEEYTEAAAATSVLVADCASTVTNEFCADHPFIYVIRHVDGKILFVGRYCSPTTN mint May be involved in the regulation of the complement cascade spi2_cwpxb Serine proteinase inhibitor 2 CRMA SPI-2 CPXV207 ICE inhibitor Cytokine response modifier protein A Hemorrhage-inducing 38 kDa protein protein protein cpv Cowpox virus (strain Brighton Red) MDIFREIASSMKGENVFISPPSISSVLTILYYGANGSTAEQLSKYVEKEADKNKDDISFKSMNKVYGRYSAVFKDSFLRKIGDNFQTVDFTDCRTVDAINKCVDIFTEGKINPLLDEPLSPDTCLLAISAVYFKAKWLMPFEKEFTSDYPFYVSPTEMVDVSMMSMYGEAFNHASVKESFGNFSIIELPYVGDTSMVVILPDNIDGLESIEQNLTDTNFKKWCDSMDAMFIDVHIPKFKVTGSYNLVDALVKLGLTEVFGSTGDYSNMCNSDVSVDAMIHKTYIDVNEEYTEAAAATCALVADCASTVTNEFCADHPFIYVIRHVDGKILFVGRYCSPTTN mint Specific and potent inhibitor of the interleukin-1-beta converting enzyme (ICE) thereby suppressing an interleukin-1 beta response to infection. The inhibition of ICE by crmA is an example of a "cross-class" interaction, in which a serpin inhibits a non-serine proteinase. Also inhibits granzyme B crma-spi_2 100365 spi2_cwpxb 100366 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 spi2_varv 100367 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role unspecified role unspecified role purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 direct interaction direct interaction false false false In the xray complex 1f0c, P07385 is chain A and P33830 is chain B Resolution 2.260 homomint mint