mpidb The Microbial Protein Interaction Database letek-2008-1 DivIVA is required for polar growth in the MreB-lacking rod-shaped actinomycete Corynebacterium glutamicum. ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Letek M., Ordóñez E., Vaquera J., Margolin W., Flärdh K., Mateos L.M., Gil J.A. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation donovan-2010-1 Subcellular localization and characterization of the ParAB system from Corynebacterium glutamicum. ecolx Escherichia coli gallex lex-a dimerization assay gallex predetermined predetermined participant predetermined Donovan C., Schwaiger A., Krämer R., Bramkamp M. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation q6m1c3_corgl parA1 cg3427 protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MEDTTWEDTPIAAAARRAAQVMTPNSLTLPKPKEPRLITIANQKGGVGKTTSTVNLAASLAIHGLKVLVVDLDPQGNASTALGVEHRSGTLSSYELLIGECTADEAMQPSTANENLFCIPATLDLAGAEIELVSLVRREYRLADALGREFIDKHDFDYMIIDCPPSLGLLTINAMTAVNEVLIPIQCEYYALEGVGQLLNNITMLRQHLNRQLHISAILLTMYDARTNLAEQVATEVNDHFGDVVLGNKIPRSVKVSEAPGYGQTVIEYDPGSRGAMAYLDAAKELATRGDYLPSDESGPIGLKPAK The sequence has been withdrawn from uniprot. q6m1c4_corgl parB cg3426 protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MAQNKGSDKSQTEKRKGGLGRGLAALIPSGPSNSPGLGGGAADIILGGTVGARTAAAPKRESTPAAPAPEAPAQAAPQHTEATKPEVVPEPAAPAPTQSAQQEAPQAQPAQQSEFGASYLEIPIEQIRPNPQQPRHEFDPQALDELVHSISEFGLMQPIVVRRSEDGYELIMGERRWRASKRAGLEVIPAIVRETEDSAMLRDALLENIHRVQLNPLEEAAAYQQLLEEFGVTQAELADKLGRSRPVITNMIRLLGLPVNVQTKVAAGVLSAGHARALLGLKAGEDAQDTLATRIIAEGLSVRATEELVLLHNRGDQDEEKKPREKAATPEVFTRAAESLADNLDTKVSVMMGKKKGKLVVEFGDKDDFERIMSLIQGQ The sequence has been withdrawn from uniprot. ftsz_corgl Cell division protein FtsZ Cgl2155 cg2366 ftsZ protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MTSPNNYLAKIKVVGVGGGGVNAVNRMIEEGLKGVEFIAVNTDSQALMFSDADVKLDIGREATRGLGAGANPEVGRASAEDHKNEIEETIKGADMVFVTAGEGGGTGTGAAPVVAGIAKKMGALTIGVVTKPFEFEGRRRTRQAEEGIAALKEVCDTLIVIPNDRLLELGDANLSIMEAFRAADEVLHNGVQGITNLITIPGVINVDFADVRSVMSEAGSALMGVGSARGDNRVVSATEQAINSPLLEATMDGATGVLLSFAGGSDLGLMEVNAAASMVRERSDEDVNLIFGTIIDDNLGDEVRVTVIATGFDAARASAAENRRAGISAAPAAEPVQQQVPTTNATLPPEKESIFGGAREENDPYLSRSAGARHRIEETRSGGGLFTTGNDRDYRRDERREDHRDERRDERRDDRSYDRRDDRRDDRRDDRGDDLDVPSFLQ q6m5f4_corgl parA2 cg1610 protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MSDAGKKDSSKVEIGLTGRPLRELPEPSPLEKHGPATIIAMANQKGGVGKTTSTINLGACLAEAGRKVLLVDLDPQGALTAGLGIHYDDVDITVYDLMVDNNSTIDQAIHHTGLPDLDVVPANIDLSAAEIQLVNEVGREQTLARALRPVMKDYDFIILDCQPSLGLLTVNALACAHGVIIPMECEYFSLRGLALLTDTVEKVADRLNFDLEILGILVTMFDRRTSHAREVMSRVVEVFDEKVFDTVITRTVRFPETSVAGEPIITWAPTSQGAEQYRSLAREVISRVND The sequence has been withdrawn from uniprot. q8nnn8_corgl Antigen 84 Cell wall synthesis protein Wag31 Cgl2150 protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MPLTPADVHNVAFNKPPIGKRGYNEDEVDQFLDLVEDALVQFQEENEDLKQQVEELEAQVAGGTSSAASSSTAGAATAAASKSVDEAALRKEIEEKLRSEYASKLDDASKAAQKAQNDAKSAQDQLQRAQADAKAARDEAEKAKAEAKSAASSSTTKAAAVGAVGAGTGAAVATGAANVDTHMQAAKVLGLAQEMADRLTSEARSESKSMLDEAREAAEKQIEEANSTSNRTLEDARANAEKQIAEAQNRADTLVNEADAKAKNLVSEAEKKSAATLAASTSRAEAQIRQAEDKANALQADAERKHTETMAAVKEQQNALETRIAELQTFEREYRTRLKSLLEGQLEELNARGSSAPTNNKPSGE div4a_strr6 Cell division protein DivIVA divIVA spr1505 protein protein strr6 Streptococcus pneumoniae (strain ATCC BAA-255 / R6) MPITSLEIKDKTFGTRFRGFDPEEVDEFLDIVVRDYEDLVRANHDKNLRIKSLEERLSYFDEIKDSLSQSVLIAQDTAERVKQAAHERSNNIIHQAEQDAQRLLEEAKYKANEILRQATDNAKKVAVETEELKNKSRVFHQRLKSTIESQLAIVESSDWEDILRPTATYLQTSDEAFKEVVSEVLGEPIPAPIEEEPIDMTRQFSQAEMEELQARIEVADKELSEFEAQIKQEVETPTPVVSPQVEEEPLLIQLAQCMKNQK div4a_bacsu Septum site-determining protein DivIVA ylmJ Cell division initiation protein DivIVA Minicell-associated protein DivIVA BSU15420 divIVA protein protein bacsu Bacillus subtilis MPLTPNDIHNKTFTKSFRGYDEDEVNEFLAQVRKDYEIVLRKKTELEAKVNELDERIGHFANIEETLNKSILVAQEAAEDVKRNSQKEAKLIVREAEKNADRIINESLSKSRKIAMEIEELKKQSKVFRTRFQMLIEAQLDLLKNDDWDHLLEYEVDAVFEEKE q9s2x4_strco Antigen 84 Cell wall synthesis protein Wag31 SCO2077 protein protein strco Streptomyces coelicolor A3(2) MPLTPEDVRNKQFTTVRLREGYDEDEVDAFLDEVEAELTRLLRENEDLRAKLAAATRAAAQNQQNMRKPPEPPQDQQHQQGPPQHQQGPPQQGGMPQQGMRGPGAPVPAGISGPPQQQMGGPMGGPPQLPSGAPQLPAGPGGQGGPQGPGPMGQGPGPMGQGPGPMQGQMGPGPMGGPMGGPQGPGGPGGPGMPGQGGPGGDSAARVLSLAQQTADQAIAEARSEANKIVGEARSRAEGLERDARAKADALERDAQEKHRVAMGSLESARATLERKVEDLRGFEREYRTRLKSYLESQLRQLETQADDSLAPPRTPATASLPPSPAPSMAPAGASAPSYGGNQSMGGGPGQSGPSYGGQQQMSPAMTQPMAPVRPQGPSPMGQAPSPMRGFLIDEDDN wag31_myctu Cell wall synthesis protein Wag31 wag31 Antigen 84 ag84 MTCY270.23 Rv2145c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVENELTRLIEENSDLRQRINELDQELAAGGGAGVTPQATQAIPAYEPEPGKPAPAAVSAGMNEEQALKAARVLSLAQDTADRLTNTAKAESDKMLADARANAEQILGEARHTADATVAEARQRADAMLADAQSRSEAQLRQAQEKADALQADAERKHSEIMGTINQQRAVLEGRLEQLRTFEREYRTRLKTYLESQLEELGQRGSAAPVDSNADAGGFDQFNRGKN diviva-diviva-7 1333111 n/a 1333112 unspecified role unspecified role prey prey n/a 1333112 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 diviva-diviva-6 1333111 not-defined-1661648702 1333113 unspecified role unspecified role prey prey n/a 1333112 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 q9s2x4-q9s2x4 1333111 not-defined-417314078 1333114 unspecified role unspecified role bait bait not-defined-1230460359 1333114 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 q9s2x4-ag84 1333111 not-defined-89118665 1333114 unspecified role unspecified role bait bait not-defined-1648223020 1333115 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 q9s2x4-q8nnn8 1333111 not-defined-1253434428 1333116 unspecified role unspecified role prey prey not-defined-408876655 1333114 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 ag84-q9s2x4 1333111 not-defined-1823291516 1333115 unspecified role unspecified role bait bait not-defined-507975401 1333114 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 ag84-ag84 1333111 not-defined-883135924 1333115 unspecified role unspecified role bait bait not-defined-549662402 1333115 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 ag84-q8nnn8 1333111 not-defined-1481067254 1333115 unspecified role unspecified role bait bait not-defined-789649591 1333116 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 diviva-diviva-8 1333111 not-defined-1553661763 1333113 unspecified role unspecified role bait bait n/a 1333112 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 diviva-diviva-4 1333111 not-defined-2064192807 1333113 unspecified role unspecified role prey prey not-defined-378808346 1333113 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 q8nnn8-q8nnn8 1333111 not-defined-367605425 1333116 unspecified role unspecified role bait bait not-defined-1453265009 1333116 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 q8nnn8-ag84 1333111 not-defined-1991932857 1333116 unspecified role unspecified role bait bait not-defined-877198157 1333115 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 q8nnn8-q9s2x4 1333111 not-defined-1434329389 1333114 unspecified role unspecified role prey prey not-defined-1260131744 1333116 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 parb-ftsz-1 1337420 n/a 1337421 unspecified role unspecified role unspecified role unspecified role not-defined-678169161 1337422 unspecified role unspecified role unspecified role unspecified role physical association physical association false false false Figure 6B para2-parb-2 1337420 n/a 1337421 unspecified role unspecified role unspecified role unspecified role not-defined-918116459 1337423 unspecified role unspecified role unspecified role unspecified role physical association physical association false false false Figure 6B para-parb-1 1337420 n/a 1337421 unspecified role unspecified role unspecified role unspecified role n/a 1337424 unspecified role unspecified role unspecified role unspecified role physical association physical association false false false Figure 6B para1-para2 1337420 n/a 1337424 unspecified role unspecified role unspecified role unspecified role not-defined-396827537 1337423 unspecified role unspecified role unspecified role unspecified role physical association physical association false false false Figure 6B para1-para1 1337420 n/a 1337424 unspecified role unspecified role bait bait n/a 1337424 unspecified role unspecified role prey prey physical association physical association false false false Figure 6A para2-para2 1337420 n/a 1337423 unspecified role unspecified role prey prey n/a 1337423 unspecified role unspecified role bait bait physical association physical association false false false Figure 6A ftsz-ftsz-6 1337420 not-defined-854885122 1337422 unspecified role unspecified role bait bait not-defined-1650347427 1337422 unspecified role unspecified role prey prey physical association physical association false false false Figure 6A MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint krawczyk-2010-1 The FHA domain of OdhI interacts with the carboxyterminal 2-oxoglutarate dehydrogenase domain of OdhA in Corynebacterium glutamicum. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Krawczyk S., Raasch K., Schultz C., Hoffelder M., Eggeling L., Bott M. FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation krawczyk-2010-2 The FHA domain of OdhI interacts with the carboxyterminal 2-oxoglutarate dehydrogenase domain of OdhA in Corynebacterium glutamicum. corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) pull down pull down predetermined predetermined participant predetermined Krawczyk S., Raasch K., Schultz C., Hoffelder M., Eggeling L., Bott M. FEBS Lett. (0014-5793) 2010 Only protein-protein interactions imex curation perez-2011-2 The role of trimerization in the osmoregulated betaine transporter BetP. in vitro In vitro bn-page blue native page bn-page predetermined predetermined participant predetermined Perez C., Khafizov K., Forrest LR., Krämer R., Ziegler C. EMBO Rep. (1469-221X) 2011 Only protein-protein interactions imex curation perez-2011-1 The role of trimerization in the osmoregulated betaine transporter BetP. in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Perez C., Khafizov K., Forrest LR., Krämer R., Ziegler C. EMBO Rep. (1469-221X) 2011 Only protein-protein interactions imex curation perez-2011-3 The role of trimerization in the osmoregulated betaine transporter BetP. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Perez C., Khafizov K., Forrest LR., Krämer R., Ziegler C. EMBO Rep. (1469-221X) 2011 Only protein-protein interactions imex curation perez-2011-4 The role of trimerization in the osmoregulated betaine transporter BetP. in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Perez C., Khafizov K., Forrest LR., Krämer R., Ziegler C. EMBO Rep. (1469-221X) 2011 Only protein-protein interactions imex curation tlzer-2016-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tölzer C., Pal S., Watzlawick H., Altenbuchner J., Niefind K. karsten.niefind@uni-koeln.de FEBS letters 2016 Only protein-protein interactions imex curation imex curation perez-2011a-1 Substrate specificity and ion coupling in the Na+/betaine symporter BetP. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Perez C., Koshy C., Ressl S., Nicklisch S., Krämer R., Ziegler C. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation koshy-2013-1 Structural evidence for functional lipid interactions in the betaine transporter BetP. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Koshy C., Schweikhard E.S., Gärtner R.M., Perez C., Yildiz O., Ziegler C. christine.ziegler@biophys.mpg.de EMBO J. (0261-4189) 2013 imex curation Only protein-protein interactions betp_corgl Glycine betaine transporter BetP Glycine betaine permease Cgl0892 cg1016 betP protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MTTSDPNPKPIVEDAQPEQITATEELAGLLENPTNLEGKLADAEEEIILEGEDTQASLNWSVIVPALVIVLATVVWGIGFKDSFTNFASSALSAVVDNLGWAFILFGTVFVFFIVVIAASKFGTIRLGRIDEAPEFRTVSWISMMFAAGMGIGLMFYGTTEPLTFYRNGVPGHDEHNVGVAMSTTMFHWTLHPWAIYAIVGLAIAYSTFRVGRKQLLSSAFVPLIGEKGAEGWLGKLIDILAIIATVFGTACSLGLGALQIGAGLSAANIIEDPSDWTIVGIVSVLTLAFIFSAISGVGKGIQYLSNANMVLAALLAIFVFVVGPTVSILNLLPGSIGNYLSNFFQMAGRTAMSADGTAGEWLGSWTIFYWAWWISWSPFVGMFLARISRGRSIREFILGVLLVPAGVSTVWFSIFGGTAIVFEQNGESIWGDGAAEEQLFGLLHALPGGQIMGIIAMILLGTFFITSADSASTVMGTMSQHGQLEANKWVTAAWGVATAAIGLTLLLSGGDNALSNLQNVTIVAATPFLFVVIGLMFALVKDLSNDVIYLEYREQQRFNARLARERRVHNEHRKRELAAKRRRERKASGAGKRR 8354B41C834CEFE2 mint odo12_corgl 2-oxoglutarate dehydrogenase E1/E2 component odhA Cgl1129 cg1280 protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MSSASTFGQNAWLVDEMFQQFQKDPKSVDKEWRELFEAQGGPNTTPATTEAQPSAPKESAKPAPKAAPAAKAAPRVETKPADKTAPKAKESSVPQQPKLPEPGQTPIRGIFKSIAKNMDISLEIPTATSVRDMPARLMFENRAMVNDQLKRTRGGKISFTHIIGYAMVKAVMAHPDMNNSYDVIDGKPTLIVPEHINLGLAIDLPQKDGSRALVVAAIKETEKMNFSEFLAAYEDIVARSRKGKLTMDDYQGVTVSLTNPGGIGTRHSVPRLTKGQGTIIGVGSMDYPAEFQGASEDRLAELGVGKLVTITSTYDHRVIQGAVSGEFLRTMSRLLTDDSFWDEIFDAMNVPYTPMRWAQDVPNTGVDKNTRVMQLIEAYRSRGHLIADTNPLSWVQPGMPVPDHRDLDIETHNLTIWDLDRTFNVGGFGGKETMTLREVLSRLRAAYTLKVGSEYTHILDRDERTWLQDRLEAGMPKPTQAEQKYILQKLNAAEAFENFLQTKYVGQKRFSLEGAEALIPLMDSAIDTAAGQGLDEVVIGMPHRGRLNVLFNIVGKPLASIFNEFEGQMEQGQIGGSGDVKYHLGSEGQHLQMFGDGEIKVSLTANPSHLEAVNPVMEGIVRAKQDYLDKGVDGKTVVPLLLHGDAAFAGLGIVPETINLAKLRGYDVGGTIHIVVNNQIGFTTTPDSSRSMHYATDYAKAFGCPVFHVNGDDPEAVVWVGQLATEYRRRFGKDVFIDLVCYRLRGHNEADDPSMTQPKMYELITGRETVRAQYTEDLLGRGDLSNEDAEAVVRDFHDQMESVFNEVKEGGKKQAEAQTGITGSQKLPHGLETNISREELLELGQAFANTPEGFNYHPRVAPVAKKRVSSVTEGGIDWAWGELLAFGSLANSGRLVRLAGEDSRRGTFTQRHAVAIDPATAEEFNPLHELAQSKGNNGKFLVYNSALTEYAGMGFEYGYSVGNEDSIVAWEAQFGDFANGAQTIIDEYVSSGEAKWGQTSKLILLLPHGYEGQGPDHSSARIERFLQLCAEGSMTVAQPSTPANHFHLLRRHALSDLKRPLVIFTPKSMLRNKAAASAPEDFTEVTKFQSVINDPNVADAAKVKKVMLVSGKLYYELAKRKEKDGRDDIAIVRIEMLHPIPFNRISEALAGYPNAEEVLFVQDEPANQGPWPFYQEHLPELIPNMPKMRRVSRRAQSSTATGVAKVHQLEEKQLIDEAFEA mint odhi_corgl Oxoglutarate dehydrogenase inhibitor odhI Cgl1441 cg1630 protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MSDNNGTPEPQVETTSVFRADLLKEMESSTGTAPASTGAENLPAGSALLVVKRGPNAGARFLLDQPTTTAGRHPESDIFLDDVTVSRRHAEFRINEGEFEVVDVGSLNGTYVNREPRNAQVMQTGDEIQIGKFRLVFLAGPAE 1AFFC8459842FCDD mint q0mrg5_9psed mekB protein protein pseudomonas veronii pseudomonas veronii MNSYYTEENHGPFELINIGPLPLEEGRCMPECLLAVAVHGALNADKSNAILVPTWYSGTSKAMEQIYIGEGRALDPSKYCIIVVNQIGNGLSSSASNTGGSLAGPGFANVRIGDDVSAQHTLLTEYFGIESLALVVGGSMGAQQTYEWAVRYPDFVKRAAAIAGTARNSEHDFLFTEILIEAITTDPAFQAGLYRSSSAVAAGLERHAKLWTLMGWSPEFFRTGRHKALGFESMQMFVDGFMKRYFAPMDPNNLLTMAWKWQRGDVSRHTGGDLAKALGRIKAKTYVMPISHDQFFTVDDCLSEQKMIPNSEFRPLRSIDGHLGLFGTDAQMLDQLDAHLAELLSSPAY q8ns43_corgl Cgl0839 protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MLDNSFYTAEVQGPYETASIGRLELEEGGVIEDCWLAYATAGTLNEDKSNAILIPTWYSGTHQTWFQQYIGTDHALDPSKYFIISINQIGNGLSVSPANTADDSISMSKFPNVRIGDDVVAQDRLLRQEFGITELFAVVGGSMGAQQTYEWIVRFPDQVHRAAPIAGTAKNTPHDFIFTQTLNETVEADPGFNGGEYSSHEEVADGLRRQSHLWAAMGFSTEFWKQEAWRRLGLESKESVLADFLDPLFMSMDPNTLLNNAWKWQHGDVSRHTGGDLAAALGRVKAKTFVMPISEDMFFPVRDCAAEQALIPGSELRVIEDIAGHLGLFNVSENYIPQIDKNLKELFES odhi-odha 891680 odhi_corgl OdhI 891682 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false odo1_corgl OdhA 891683 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false domino mint f3b f3c f3d odhi-odha-1 891681 odhi_corgl OdhI 891682 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false odo1_corgl OdhA 891683 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false physical association physical association false false false f2a f2b domino mint betp-1 1179961 betp_corgl BetP 1179965 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P54582:p.Trp101Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P54582:p.Thr351Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P54582:p.Phe345Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 3.0 direct interaction direct interaction false false false mint f2 sf2 betp-1 1179961 betp_corgl BetP 1179965 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P54582:p.Trp101Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P54582:p.Thr351Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 3.0 direct interaction direct interaction false false false mint f2 sf2 betp-1 1179961 betp_corgl BetP 1179965 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified P54582:p.Leu330Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P54582:p.Leu341Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P54582:p.Asn331Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 3.0 direct interaction direct interaction false false false mint f2 sf2 betp-1 1179961 betp_corgl BetP 1179965 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified P54582:p.Trp101Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P54582:p.Thr351Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 3.0 direct interaction direct interaction false false false mint f2 sf2 betp-1 1179961 betp_corgl BetP 1179965 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified P54582:p.Thr351Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P54582:p.Trp101Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P54582:p.Phe345Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 3.0 direct interaction direct interaction false false false mint f3 sf4 betp-1 1179961 betp_corgl BetP 1179965 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified P54582:p.Trp101Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P54582:p.Thr351Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 3.0 direct interaction direct interaction false false false mint f3 sf4 betp 1179962 betp_corgl BetP 1179965 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified P54582:p.Trp101Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P54582:p.Thr351Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 3.0 direct interaction direct interaction false false false f4a mint betp-1 1179963 betp_corgl BetP 1179965 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P54582:p.Trp101Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P54582:p.Thr351Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 3.0 direct interaction direct interaction false false false sf3 mint betp-1 1179964 betp_corgl BetP 1179965 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P54582:p.Trp101Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P54582:p.Thr351Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 3.0 direct interaction direct interaction false false false mint f3 sf4 q8ns43_corgl-1 1915827 n/a 1915828 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false T1 mekb-1 1915827 n/a 1915829 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false T1 betp-1 1141565 betp_corgl betP 1179965 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 3.0 direct interaction direct interaction false false false mint f4 t2 Coordinates and structure factors heve been deposited in the Protein Data Bank with accession code 3PO3. betp-1 1478054 n/a 1179965 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 3.0 direct interaction direct interaction false false false st1 f1 sf2 sf3 DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ressl-2009-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ressl S., Terwisscha van Scheltinga AC., Vonrhein C., Ott V., Ziegler C. DIP original experiment: DIP-249835X Nature 2009 IMEx Molecular basis of transport and regulation in the Na(+)/betaine symporter BetP. Ressl S., Terwisscha van Scheltinga AC., Vonrhein C., Ott V., Ziegler C. Only protein-protein interactions imex curation ressl-2009-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ressl S., Terwisscha van Scheltinga AC., Vonrhein C., Ott V., Ziegler C. DIP original experiment: DIP-249836X Nature 2009 IMEx Molecular basis of transport and regulation in the Na(+)/betaine symporter BetP. Ressl S., Terwisscha van Scheltinga AC., Vonrhein C., Ott V., Ziegler C. Only protein-protein interactions imex curation barthe-2009-1 in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Barthe P., Roumestand C., Canova MJ., Kremer L., Hurard C., Molle V., Cohen-Gonsaud M. DIP original experiment: DIP-132097X Structure (London, England : 1993) 2009 IMEx Dynamic and structural characterization of a bacterial FHA protein reveals a new autoinhibition mechanism. Barthe P., Roumestand C., Canova MJ., Kremer L., Hurard C., Molle V., Cohen-Gonsaud M. Only protein-protein interactions imex curation barthe-2009-2 in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Barthe P., Roumestand C., Canova MJ., Kremer L., Hurard C., Molle V., Cohen-Gonsaud M. DIP original experiment: DIP-132098X Structure (London, England : 1993) 2009 IMEx Dynamic and structural characterization of a bacterial FHA protein reveals a new autoinhibition mechanism. Barthe P., Roumestand C., Canova MJ., Kremer L., Hurard C., Molle V., Cohen-Gonsaud M. Only protein-protein interactions imex curation perez-2012-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Perez C., Koshy C., Yildiz O., Ziegler C. DIP original experiment: DIP-251035X Nature 2012 IMEx Alternating-access mechanism in conformationally asymmetric trimers of the betaine transporter BetP. Perez C., Koshy C., Yildiz O., Ziegler C. Only protein-protein interactions imex curation odhi_corgl Oxoglutarate dehydrogenase inhibitor odhI Cgl1441 cg1630 protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MSDNNGTPEPQVETTSVFRADLLKEMESSTGTAPASTGAENLPAGSALLVVKRGPNAGARFLLDQPTTTAGRHPESDIFLDDVTVSRRHAEFRINEGEFEVVDVGSLNGTYVNREPRNAQVMQTGDEIQIGKFRLVFLAGPAE 1AFFC8459842FCDD mint pkn2_corgl Serine/threonine-protein kinases PknA pknA drp72 Cgl0042 cg0059 protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MSQEDITGKDRLQELIGADYRLQWIIGHGGMSTVWLADDVVNDREVAIKVLRPEFSDNQEFLNRFRNEAQAAENIDSEHVVATYDYREVPDPAGHTFCFIVMEFVRGESLADLLEREGRLPEDLALDVMEQAAHGLSVIHRMDMVHRDIKPGNMLITANGIVKITDFGIAKAAAAVPLTRTGMVVGTAQYVSPEQAQGKEVTAASDIYSLGVVGYEMMAGRRPFTGDSSVSVAIAHINQAPPQMPTSISAQTRELIGIALRKDPGRRFPDGNEMALAVSAVRLGKRPPQPRTSAMMAQAEAPSPSESTAMLGRVARPATITQEAAPKRGSGIGIGLFIAALLAVIIGAVIYAGTTGILFNDTPEETTTPETITETYTPTVEETTSQWVPPTPPTRSTFTEPETTSHRPTTSEESTSEEPTTEAPTSSRTVPQIPTSTPRTSASVPVETNAPADDLIDAVNGLLDVGGAQ 53C10AD97BB95595 pkn1_corgl Probable serine/threonine-protein kinase PknB pknB Cgl0041 cg0057 protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MTFVIADRYELDAVIGSGGMSEVFAATDTLIGREVAVKMLRIDLAKDPNFRERFRREAQNSGRLSHSSIVAVFDTGEVDKDGTSVPYIVMERVQGRNLREVVTEDGVFTPVEAANILIPVCEALQASHDAGIIHRDVKPANIMITNTGGVKVMDFGIARAVNDSTSAMTQTSAVIGTAQYLSPEQARGKPADARSDIYATGCVMYELVTGKPPFEGESPFAVAYQHVQEDPTPPSDFIADLTPTSAVNVDAVVLTAMAKHPADRYQTASEMAADLGRLSRNAVSHAARAHVETEETPEEPETRFSTRTSTQVAPAAGVAAASTGSGSSSRKRGSRGLTALAIVLSLGVVGVAGAFTYDYFANSSSTATSAIPNVEGLPQQEALTELQAAGFVVNIVEEASADVAEGLVIRANPSVGSEIRQGATVTITVSTGREMINIPDVSGMTLEDAARALEDVGLILNQNVREETSDDVESGLVIDQNPEAGQEVVVGSSVSLTMSSGTESIRVPNLTGMNWSQAEQNLISMGFNPTASYLDSSEPEGEVLSVSSQGTELPKGSSITVEVSNGMLIQAPDLARMSTEQAISALRAAGWTAPDQSLIVGDPIHTAALVDQNKIGFQSPTPATLFRKDAQVQVRLFEFDLAALVQ 0F3B4980ECF73BFB betp_corgl Glycine betaine transporter BetP Glycine betaine permease Cgl0892 cg1016 betP protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MTTSDPNPKPIVEDAQPEQITATEELAGLLENPTNLEGKLADAEEEIILEGEDTQASLNWSVIVPALVIVLATVVWGIGFKDSFTNFASSALSAVVDNLGWAFILFGTVFVFFIVVIAASKFGTIRLGRIDEAPEFRTVSWISMMFAAGMGIGLMFYGTTEPLTFYRNGVPGHDEHNVGVAMSTTMFHWTLHPWAIYAIVGLAIAYSTFRVGRKQLLSSAFVPLIGEKGAEGWLGKLIDILAIIATVFGTACSLGLGALQIGAGLSAANIIEDPSDWTIVGIVSVLTLAFIFSAISGVGKGIQYLSNANMVLAALLAIFVFVVGPTVSILNLLPGSIGNYLSNFFQMAGRTAMSADGTAGEWLGSWTIFYWAWWISWSPFVGMFLARISRGRSIREFILGVLLVPAGVSTVWFSIFGGTAIVFEQNGESIWGDGAAEEQLFGLLHALPGGQIMGIIAMILLGTFFITSADSASTVMGTMSQHGQLEANKWVTAAWGVATAAIGLTLLLSGGDNALSNLQNVTIVAATPFLFVVIGLMFALVKDLSNDVIYLEYREQQRFNARLARERRVHNEHRKRELAAKRRRERKASGAGKRR 8354B41C834CEFE2 mint betp-2 3185475 N/A 3185477 unspecified role unspecified role unspecified role unspecified role Region 30-595 Region 30-595 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false betp-3 3185476 N/A 3185477 unspecified role unspecified role unspecified role unspecified role Region 30-595 Region 30-595 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false cgpkna-odhi-1 3187104 N/A 3187106 enzyme target enzyme target substrate substrate unspecified role unspecified role pT15 pT15 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3187107 enzyme enzyme unspecified role unspecified role Region 1-332 Region 1-332 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false cgpknb-odhi-1 3187105 N/A 3187106 enzyme target enzyme target substrate substrate unspecified role unspecified role pT15 pT15 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3187108 enzyme enzyme unspecified role unspecified role Region 1-313 Region 1-313 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false false false betp-4 3244760 N/A 3185477 unspecified role unspecified role unspecified role unspecified role Region 30-595 Region 30-595 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false