DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chen-2009-14 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Chen HJ., Ko TP., Lee CY., Wang NC., Wang AH. DIP original experiment: DIP-132087X Structure (London, England : 1993) 2009 IMEx Structure, assembly, and mechanism of a PLP-dependent dodecameric L-aspartate beta-decarboxylase. Chen HJ., Ko TP., Lee CY., Wang NC., Wang AH. Only protein-protein interactions imex curation chen-2009-17 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chen HJ., Ko TP., Lee CY., Wang NC., Wang AH. DIP original experiment: DIP-132085X Structure (London, England : 1993) 2009 IMEx Structure, assembly, and mechanism of a PLP-dependent dodecameric L-aspartate beta-decarboxylase. Chen HJ., Ko TP., Lee CY., Wang NC., Wang AH. Only protein-protein interactions imex curation chen-2009-18 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chen HJ., Ko TP., Lee CY., Wang NC., Wang AH. DIP original experiment: DIP-132086X Structure (London, England : 1993) 2009 IMEx Structure, assembly, and mechanism of a PLP-dependent dodecameric L-aspartate beta-decarboxylase. Chen HJ., Ko TP., Lee CY., Wang NC., Wang AH. Only protein-protein interactions imex curation asda_comte Bifunctional aspartate aminotransferase and L-aspartate beta-decarboxylase asD Aspartate 4-decarboxylase protein protein comte comte Pseudomonas testosteroni MSKDYQSLAKLSPFELKDELIKIASSDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTTVGVGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSNRPSGRASLANLNEYEYAAIGRALRKMADELYAEYSGQAQNL B6E0042383A51113 asda-1 3187045 N/A 3187050 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false asda-2 3187048 N/A 3187050 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false asda-3 3187049 N/A 3187050 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false