DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chen-2020-14 chlte Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) 3d-em-single electron microscopy 3D single particle reconstruction 3D-EM-single experimental particp experimental participant identification experimental particp Chen JH., Wu H., Xu C., Liu XC., Huang Z., Chang S., Wang W., Han G., Kuang T., Shen JR., Zhang X. xzhang1999@zju.edu.cn (X.Z); shen@cc.okayama-u.ac.jp (J.-R.S.); kuangty@ibcas.ac.cn (T.K.) Science (New York, N.Y.) 2020 Only protein-protein interactions imex curation imex curation chen-2020-19 chlte Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) density sedimentation cosedimentation through density gradient density sedimentation experimental particp experimental participant identification experimental particp Chen JH., Wu H., Xu C., Liu XC., Huang Z., Chang S., Wang W., Han G., Kuang T., Shen JR., Zhang X. xzhang1999@zju.edu.cn (X.Z); shen@cc.okayama-u.ac.jp (J.-R.S.); kuangty@ibcas.ac.cn (T.K.) Science (New York, N.Y.) 2020 Only protein-protein interactions imex curation imex curation li-2005-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Li H., Sawaya MR., Tabita FR., Eisenberg D. DIP original experiment: DIP-132764X Structure (London, England : 1993) 2005 IMEx Crystal structure of a RuBisCO-like protein from the green sulfur bacterium Chlorobium tepidum. Li H., Sawaya MR., Tabita FR., Eisenberg D. Only protein-protein interactions imex curation li-2005-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Li H., Sawaya MR., Tabita FR., Eisenberg D. DIP original experiment: DIP-132765X Structure (London, England : 1993) 2005 IMEx Crystal structure of a RuBisCO-like protein from the green sulfur bacterium Chlorobium tepidum. Li H., Sawaya MR., Tabita FR., Eisenberg D. Only protein-protein interactions imex curation meyer-2009-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Meyer S., Böhme S., Krüger A., Steinhoff HJ., Klare JP., Wittinghofer A. DIP original experiment: DIP-132686X PLoS biology 2009 IMEx Kissing G domains of MnmE monitored by X-ray crystallography and pulse electron paramagnetic resonance spectroscopy. Meyer S., Böhme S., Krüger A., Steinhoff HJ., Klare JP., Wittinghofer A. Only protein-protein interactions imex curation meyer-2009-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Meyer S., Böhme S., Krüger A., Steinhoff HJ., Klare JP., Wittinghofer A. DIP original experiment: DIP-132691X PLoS biology 2009 IMEx Kissing G domains of MnmE monitored by X-ray crystallography and pulse electron paramagnetic resonance spectroscopy. Meyer S., Böhme S., Krüger A., Steinhoff HJ., Klare JP., Wittinghofer A. Only protein-protein interactions imex curation rbll_chlte Ribulose bisphosphate carboxylase-like protein CT1772 protein protein chlte Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) MNAEDVKGFFASRESLDMEQYLVLDYYLESVGDIETALAHFCSEQSTAQWKRVGVDEDFRLVHAAKVIDYEVIEELEQLSYPVKHSETGKIHACRVTIAHPHCNFGPKIPNLLTAVCGEGTYFTPGVPVVKLMDIHFPDTYLADFEGPKFGIEGLRDILNAHGRPIFFGVVKPNIGLSPGEFAEIAYQSWLGGLDIAKDDEMLADVTWSSIEERAAHLGKARRKAEAETGEPKIYLANITDEVDSLMEKHDVAVRNGANALLINALPVGLSAVRMLSNYTQVPLIGHFPFIASFSRMEKYGIHSKVMTKLQRLAGLDAVIMPGFGDRMMTPEEEVLENVIECTKPMGRIKPCLPVPGGSDSALTLQTVYEKVGNVDFGFVPGRGVFGHPMGPKAGAKSIRQAWEAIEQGISIETWAETHPELQAMVDQSLLKKQD 41C282555ED2ECB0 bcpa_chlte Bacteriochlorophyll a protein Fenna-Matthews-Olson protein CT1499 fmoA protein protein chlte Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) MALFGSNDVTTAHSDYEIVLEGGSSSWGKVKARAKVNAPPASPLLPADCDVKLNVKPLDPAKGFVRISAVFESIVDSTKNKLTIEADIANETKERRISVGEGMVSVGDFSHTFSFEGSVVNLFYYRSDAVRRNVPNPIYMQGRQFHDILMKVPLDNNDLIDTWEGTVKAIGSTGAFNDWIRDFWFIGPAFTALNEGGQRISRIEVNGLNTESGPKGPVGVSRWRFSHGGSGMVDSISRWAELFPSDKLNRPAQVEAGFRSDSQGIEVKVDGEFPGVSVDAGGGLRRILNHPLIPLVHHGMVGKFNNFNVDAQLKVVLPKGYKIRYAAPQYRSQNLEEYRWSGGAYARWVEHVCKGGVGQFEILYAQ q8kay0_chlte CT2020 protein protein chlte Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) MAEQVKPAGVKPKGTVPPPKGNAPAPKANGAPGGASVIKEQDAAKMRRFLFQRTETRSTKWYQIFDTEKLDDEQVVGGHLALLGVLGFIMGIYYISGIQVFPWGAPGFHDNWFYLTIKPRMVSLGIDTYSTKTADLEAAGARLLGWAAFHFLVGSVLIFGGWRHWTHNLTNPFTGRCGNFRDFRFLGKFGDVVFNGTSAKSYKEALGPHAVYMSLLFLGWGIVMWAILGFAPIPDFQTINSETFMSFVFAVIFFALGIYWWNNPPNAAIHLNDDMKAAFSVHLTAIGYINIALGCIAFVAFQQPSFAPYYKELDKLVFYLYGEPFNRVSFNFVEQGGKVISGAKEFADFPAYAILPKSGEAFGMARVVTNLIVFNHIICGVLYVFAGVYHGGQYLLKIQLNGMYNQIKSIWITKGRDQEVQVKILGTVMALCFATMLSVYAVIVWNTICELNIFGTNITMSFYWLKPLPIFQWMFADPSINDWVMAHVITAGSLFSLIALVRIAFFAHTSPLWDDLGLKKNSYSFPCLGPVYGGTCGVSIQDQLWFAMLWGIKGLSAVCWYIDGAWIASMMYGVPAADAKAWDSIAHLHHHYTSGIFYYFWTETVTIFSSSHLSTILMIGHLVWFISFAVWFEDRGSRLEGADIQTRTIRWLGKKFLNRDVNFRFPVLTISDSKLAGTFLYFGGTFMLVFLFLANGFYQTNSPLPPPVSHAAVSGQQMLAQLVDTLMKMIA q8kay1_chlte pscB CT2019 protein protein chlte Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) MAEPVENKNQAPAPGAKVPPKGAPAAPKAGAPAAPKGPVAPKAGAPAAKTGASAAKQAGKPRLASLGVTLGRSGVRQESALPYVKPKAVPPPKPAAPAAKGAPAPKGAPAAPAAKAAPGAPVAKAAPKAKKHYFIIENLCVGCGLCLDKCPPKVNAIGYKFYGDVQEGGFRCYIDQAACISCSACFSGDECPSGALIEVLPDGEVLDFSYTPPERLDFDLRFLHRFHREAR pscd_chlte P840 reaction center 17 kDa protein pscD CT0641 protein protein chlte Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) MQPQLSRPQTASNQVRKAVSGPWSGNAVHKAEKYFITSAKRDRDGKLQIELVPASGRRKLSPTPEMIRRLIDGEIEIYILTTQPDIAIDMNKEIIDMENRYVIDFDKRGVKWTMREIPVFYHEGKGLCVELHNKIYTLDQFFK mnme_chlte tRNA modification GTPase MnmE mnmE thdF trmE CT2084 protein protein chlte Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) MSPSDLHLPVPGHPIAAIATPVGVGALAIVRISGAGVLDLADRVFRKVHGSGKLAEAAGYTAHFGRLYDGEEMVDEVIALVFRAPRSFTAEQMVEFTCHGGPVVVGRVLRLMLDNGCRLAEPGEFTRRAFLNGRIDLLQAEAIGEMIHARTESAYRTAVSQMKGDLSVRLGGLREQLIRSCALIELELDFSEEDVEFQSRDELTMQIETLRSEVNRLIDSYQHGRIVSEGVSTVIAGKPNAGKSTLLNTLLGQERAIVSHMPGTTRDYIEECFIHDKTMFRLTDTAGLREAGEEIEHEGIRRSRMKMAEADLILYLLDLGTERLDDELTEIRELKAAHPAAKFLTVANKLDRAANADALIRAIADGTGTEVIGISALNGDGIDTLKQHMGDLVKNLDKLHEASVLVTSLRHYEALRNASDALQNALELIAHESETELIAFELRAALDYVGQITGKVVNEEVLNTIFDKFCIGK B7F2E17B3A8793E2 fmoa-1 3965707 N/A 3965709 structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level chlte Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) Stoichiometry: 2.0 N/A 3965710 structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level chlte Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) Stoichiometry: 1.0 N/A 3965711 structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level chlte Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) Stoichiometry: 1.0 N/A 3965712 structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified chlte Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) Stoichiometry: 3.0 physical association physical association false false false Figure 1, Table S1 fmoa-pscb-1 3965708 N/A 3965709 structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level chlte Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) N/A 3965710 structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level chlte Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) N/A 3965711 structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level chlte Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) N/A 3965712 structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component purified purified chlte Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) physical association physical association false false false Figure S1c rlp-1 3137797 N/A 3137799 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false rlp-2 3137798 N/A 3137799 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ctmnme-1 3197246 N/A 3197253 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false ctmnme-2 3197249 N/A 3197253 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ giambattista-2016-9 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Giambattista Guaitoli, Giambattista Guaitoli Parkinsons - Interactions investigated in the context of Parkinsons disease The authors have stated that:- "The material used for EM came from transgenic mice, expressing FLAG-tagged murine forms of WT Lrrk2 as described in Ref. 29." iban.ubarretxena@mssm.edu,a.kortholt@rug.nl,johannes.gloeckner@dzne.de PNAS 2016 imex curation Giambattista Guaitoli, Giambattista Guaitoli, Giambattista Guaitoli, Giambattista Guaitoli Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Only protein-protein interactions giambattista-2016-10 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Giambattista Guaitoli, Giambattista Guaitoli Parkinsons - Interactions investigated in the context of Parkinsons disease The authors have stated that:- "The material used for EM came from transgenic mice, expressing FLAG-tagged murine forms of WT Lrrk2 as described in Ref. 29." iban.ubarretxena@mssm.edu,a.kortholt@rug.nl,johannes.gloeckner@dzne.de PNAS 2016 imex curation Giambattista Guaitoli, Giambattista Guaitoli, Giambattista Guaitoli, Giambattista Guaitoli Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Only protein-protein interactions q8kc98_chlte CT1526 protein protein chlte Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) MSDLDVIRQIEQELGMQLEPVDKLKWYSKGYKLDKDQRVTAIGLYDCGSDTLDRIIQPLESLKSLSELSLSSNQITDISPLASLNSLSMLWLDRNQITDIAPLASLNSLSMLWLFGNKISDIAPLESLKSLTELQLSSNQITDIAPLASLKSLTELSLSGNNISDIAPLESLKSLTELSLSSNQITDIAPLASLKSLTELSLSSNQISDIAPLESLKSLTELQLSRNQISDIAPLESLKSLTELQLSSNQITDIAPLASLKSLTELQLSRNQISDIAPLESLNSLSKLWLNGNQITDIAPLASLNSLTELELSSNQITDIAPLASLKSLSTLWLSSNQISDIAPLASLESLSELSLSSNQISDISPLASLNSLTGFDVRRNPIKRLPETITGFDMEILWNDFSSSGFITFFDNPLESPPPEIVKQGKEAVRQYFQSIEEARSKGEALVHLQEIKVHLIGDGMAGKTSLLKQLIGETFDPKESQTHGLNVVTKQAPNIKGLENDDELKECLFHFWDFGGQEIMHASHQFFMTRSSVYMLLLDSRTDSNKHYWLRHIEKYGGKSPVIVVMNKIDENPSYNIEQKKINERFPAIENRFHRISCKNGDGVESIAKSLKSAVLHPDSIYGTPLAPSWIKVKEKLVEATTAQRYLNRTEVEKICNDSGITDPGERKTLLGYLNNLGIVLYFEALDLSEIYVLDPHWVTIGVYRIINSSKTKNGHLNTSALGYILNEEQIRCDEYDPAKNNKFTYTLLEQRYLLDIMKQFELCYDEGKGLFIIPSNLPTQIDNEPEITEGEPLRFIMKYDYLPSTIIPRLMIAMQHQILDRMQWRYGMVLKSQDHEGALAKVVAETKDSTITIAIQGEPRCKREYLSIIWYEIKKINANFTNLDVKEFIPLPGHPDELVEYKELLGLEKMGRDEYVSGKLEKVFSVSKMLDSVISKEERNKERLMGDINIKLENIGNPTIPIHQQVEVNVSQETVQHVENLQGFFENLKADILREAELEIDDPKERKRLANELELAENAITKMDAAVKSGKNKLKPDVKDRLGEFIDNLANENSRLRKGIALVMNGAEKVQKLARYYNNVAPFFDLPSVPPVLLGKEKT mint q8kc98_chlte-q8kc98_chlte-2 2824493 N/A 2824500 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 2824500 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false Table S1 2.3A R work 0.214 R free 0.261 q8kc98_chlte-q8kc98_chlte-1 2824494 N/A 2824500 unspecified role unspecified role neutral component neutral component LRR-roc-cor sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 2824500 unspecified role unspecified role neutral component neutral component LRR-roc-cor sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 2824655 2824653 direct interaction direct interaction false false false Dataset S9, supp Fig 10. MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint gotthard-2008-1 Structure of the Roc-COR domain tandem of C. tepidum, a prokaryotic homologue of the human LRRK2 Parkinson kinase. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gotthardt K., Weyand M., Kortholt A., Van Haastert PJ., Wittinghofer A. EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation Gotthardt K., Weyand M., Kortholt A., Van Haastert P.J., Wittinghofer A. gotthard-2008-2 Structure of the Roc-COR domain tandem of C. tepidum, a prokaryotic homologue of the human LRRK2 Parkinson kinase. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Gotthardt K., Weyand M., Kortholt A., Van Haastert PJ., Wittinghofer A. EMBO J. (0261-4189) 2008 Only protein-protein interactions imex curation Gotthardt K., Weyand M., Kortholt A., Van Haastert P.J., Wittinghofer A. q8kc98_chlte CT1526 protein protein chlte Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) MSDLDVIRQIEQELGMQLEPVDKLKWYSKGYKLDKDQRVTAIGLYDCGSDTLDRIIQPLESLKSLSELSLSSNQITDISPLASLNSLSMLWLDRNQITDIAPLASLNSLSMLWLFGNKISDIAPLESLKSLTELQLSSNQITDIAPLASLKSLTELSLSGNNISDIAPLESLKSLTELSLSSNQITDIAPLASLKSLTELSLSSNQISDIAPLESLKSLTELQLSRNQISDIAPLESLKSLTELQLSSNQITDIAPLASLKSLTELQLSRNQISDIAPLESLNSLSKLWLNGNQITDIAPLASLNSLTELELSSNQITDIAPLASLKSLSTLWLSSNQISDIAPLASLESLSELSLSSNQISDISPLASLNSLTGFDVRRNPIKRLPETITGFDMEILWNDFSSSGFITFFDNPLESPPPEIVKQGKEAVRQYFQSIEEARSKGEALVHLQEIKVHLIGDGMAGKTSLLKQLIGETFDPKESQTHGLNVVTKQAPNIKGLENDDELKECLFHFWDFGGQEIMHASHQFFMTRSSVYMLLLDSRTDSNKHYWLRHIEKYGGKSPVIVVMNKIDENPSYNIEQKKINERFPAIENRFHRISCKNGDGVESIAKSLKSAVLHPDSIYGTPLAPSWIKVKEKLVEATTAQRYLNRTEVEKICNDSGITDPGERKTLLGYLNNLGIVLYFEALDLSEIYVLDPHWVTIGVYRIINSSKTKNGHLNTSALGYILNEEQIRCDEYDPAKNNKFTYTLLEQRYLLDIMKQFELCYDEGKGLFIIPSNLPTQIDNEPEITEGEPLRFIMKYDYLPSTIIPRLMIAMQHQILDRMQWRYGMVLKSQDHEGALAKVVAETKDSTITIAIQGEPRCKREYLSIIWYEIKKINANFTNLDVKEFIPLPGHPDELVEYKELLGLEKMGRDEYVSGKLEKVFSVSKMLDSVISKEERNKERLMGDINIKLENIGNPTIPIHQQVEVNVSQETVQHVENLQGFFENLKADILREAELEIDDPKERKRLANELELAENAITKMDAAVKSGKNKLKPDVKDRLGEFIDNLANENSRLRKGIALVMNGAEKVQKLARYYNNVAPFFDLPSVPPVLLGKEKT mint q8kc98 834812 q8kc98_chlte COR 834814 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q8KC98:p.Glu917Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 direct interaction direct interaction false false false f3d mint q8kc98-1 834812 q8kc98_chlte COR 834814 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 direct interaction direct interaction false false false f3d mint q8kc98-1 834812 q8kc98_chlte Roc-COR 834814 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 direct interaction direct interaction false false false f4a mint q8kc98-1 834813 q8kc98_chlte COR 834814 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 direct interaction direct interaction false false false mint f3c sf2 q8kc98-1 834813 q8kc98_chlte Roc-COR 834814 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 direct interaction direct interaction false false false f4b mint