IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tan-2007-9 chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell African green monkey kidney epithelial cells epithelium Epithelium [epithelial cells] coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip antibody detection identification by antibody antibody detection Tan YX., Tan TH., Lee MJ., Tham PY., Gunalan V., Druce J., Birch C., Catton M., Fu NY., Yu VC., Tan YJ. Coronavirus - Interactions investigated in the context of Coronavirus mcbtanyj@imcb.a-star.edu.sg Journal of virology 2007 Only protein-protein interactions imex curation imex curation ns7a_sars ORF7a protein Accessory protein 7a Protein U122 Protein X4 7a protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MKIILFLTLIVFTSCELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTYQLRARSVSPKLFIRQEEVQQELYSPLFLIVAALVFLILCFTIKRKTE a0a0d9rjz8_chlsb Apoptosis regulator Bcl-X BCL2L1 Bcl-2-like protein 1 protein protein chlsb chlsb Green monkey Cercopithecus sabaeus MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQTLREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK bcl2l1-rep-1 3681143 N/A 3681145 unspecified role unspecified role prey prey living cell living cell N/A 3681150 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig 2 C HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html labiuk-2010-4 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Labiuk SL., Lobanov V., Lawman Z., Snider M., Babiuk LA., van Drunen Littel-van den Hurk S. Virus - Publications including interactions involving viral proteins The 108 strain of BoHV-1 is stated to have been in all experiments but there is no UniProt entry for this strain. The NCBI identifier NP_045368 is stated to be used for US3 protein. For US3 protein the top level TAX_id is 10320 (BHV-1) corresponding to UniProt Q76PF3-which has 100% identity to NP_045368 protein,which is used here. A minor difference from the US3 sequence in NP_045368 was noted, such that in strain 108, bases 319, 324, 325 and 327 are guanine instead of adenine. For VP22 protein the NCBI entry NP_045310 is used in the study. NP_045310 is 100% match to P30022 - Cooper strain, which is confirmed by following up references (from PMID:15650221). sylvia.vandenhurk@usask.ca The Journal of general virology 2010 imex curation Only protein-protein interactions imex curation vp22_bhv1c Tegument protein VP22 UL49 protein protein bhv1c Bovine herpesvirus 1.1 (strain Cooper) BoHV-1 Infectious bovine rhinotracheitis virus MARFHRPSEDEDDYEYSDLWVRENSLYDYESGSDDHVYEELRAATSGPEPSGRRASVRACASAAAVQPAARGRDRAAAAGTTVAAPAAAPARRSSSRASSRPPRAAADPPVLRPATRGSSGGAGAVAVGPPRPRAPPGANAVASGRPLAFSAAPKTPKAPWCGPTHAYNRTIFCEAVALVAAEYARQAAASVWDSDPPKSNERLDRMLKSAAIRILVCEGSGLLAAANDILAARAQRPAARGSTSGGESRLRGERARP a0a0d9r898_chlsb Casein kinase II subunit beta CSNK2B protein protein chlsb chlsb Green monkey Cercopithecus sabaeus MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPSSCSRHPDLPLLPLRRPFCRMHFRLREVYHQQLIPMHGDHHLL vp22-ck2b-1 1882616 N/A 1882619 unspecified role unspecified role prey prey N/A 1882618 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 6C