mpidb The Microbial Protein Interaction Database kirsch-2012-3 Essential amino acid residues of BioY reveal that dimers are the functional S unit of the Rhodobacter capsulatus biotin transporter. ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds weight by comassie molecular weight estimation by coomasie staining weight by comassie Kirsch F., Frielingsdorf S., Pohlmann A., Ziomkowska J., Herrmann A., Eitinger T. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation q5ln73_ruepo Biotin transporter SPO3339 protein protein ruepo Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) Silicibacter pomeroyi MKQTTEAVVAGARAPALSGQILRVAAGIAILTLSARVQVPFWPVPMTLQVAAVMALAALYGMRLGTATLAGYLAVGALGLPVFAGTPEKGLGLAYMLGGTGGYLVGFLVASALVGFAADRLHRLALWPAMLLGLAVIYALGLAWLAQFVPADKLLAYGMTPFVAGDLVKVTLAALLVTKLPQGWAERLRGGARHG a3u2l6_psebh Biotin transporter OB2597_04098 protein protein oceanicola batsensis htcc2597 Oceanicola batsensis HTCC2597 MSQASTARVLTEAFGPTEGAALRLKQAALVVAGIALLAVCAKIKLPVPGSPVAVGMGTFAVLGIGAAYGAKLGLTTIMGYMLIGLLGFDIFQSSTAELNGVDYMMGSTGGYLLGYVLATVLLGALAQRGWDRSVLWMALAMLLGNILLYIPGLGWLGMLYGWDKPILEWGLTPFIIGDLLKLALAALILPAAWKLIGRARG q6n716_rhopa Biotin transporter RPA2447 protein protein rhopa Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) MPLGSSAPPRMGGHTALAAALWPRRTDGFSAWLRMAVLIAFGSVLLALSAKVNLPLPLVPMTLQTLMVVLIGAAYGARLGAATVLAYLAEGAAGLPVFAGPVGGLAPLLGPTAGYLAGFVVAAVLVGWCADRGFDRSVAKLFAAMLAGHLAILTLGFAWLAFGLHLGLAKAWWVGVVPFLAGSLVKSALGAALLPAVRRIVDRQR a9cjy4_agrfc Biotin transporter bioY Atu0749 protein protein agrt5 Agrobacterium tumefaciens (strain C58 / ATCC 33970) Agrobacterium tumefaciens (strain C58) MTTRDLVLISLFSAIIIALGLLPPITLGFIPVPITAQSLGVMLAGVVLGAKRGTLAVLLTILIAGIGLPVLSGGRGGLSIFTTPTTGFLIGWIAAVFVTGFLSEKFVHSGQSALAQGVGFFVASLIGGVVVLYAFGITYLALVVGLGFEKAFIGSLLFIPGDALKAVLAALAGRAVMAGYPLLPQRA bioy_rhocb Biotin transporter BioY bioY Biotin ECF transporter S component BioY RCAP_rcc03249 protein protein rhocb Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) MERNVTLIGLFAALIVALGFVPAIPLGFGVPITLQSLGVMLAGAVLGSWRGALAVLLVQALVAIGLPVLAGGRGGLGIFVGPTAGFLIGWLPAAFVTGLIVERLRRVPVALAAGIGATLGGIIIMYALGILGFWLVKNAGLKPEDAPISLWAATAIMAPFIPGDLVKVVVTGLVARTIAQYRPSALLARG a3tzi7_psebh Biotin transporter OB2597_17167 protein protein oceanicola batsensis htcc2597 Oceanicola batsensis HTCC2597 MTREISIILVGTILLTISAKIVVPFYPVPMSTQTLVVLGLGLFLGPVRSSLVVVTYLFEGLLGLPVFAGTPPAPAGLAYIAGPTGGYLVGFALAAAAAGWVVQALQGLWPSFRASVAVFSGSILMYCAGLFWLGGFVGYGEKLLNAGLYPFLIGDLTKATIAVVLYSAYHNRRAV q89m96_bradu Biotin transporter blr4297 protein protein braja Bradyrhizobium japonicum (strain USDA 110) MWPTRPGETVGALRAFVLVALGTALLALSAKVNLPLPYVPMTLQTLVVLMIGAAYGWRLGSATMIAYLAEGALGLPVFAGPVGGIAPLVGPTAGYLFGFIAAAFVTGWLAERGWDRSVVLLFAAMAVGHIVILAAGFGWLAFGLGLGASKAWQVGLAPFIAASLVKNALGATLMPAARRIVDRRG q166h5_rosdo Biotin transporter bioY RD1_2561 protein protein rosdo Roseobacter denitrificans (strain ATCC 33942 / OCh 114) MQMSASHSVLADQFGPAAGTARRIKQAVLVVLGIAVLAVAANIKVPVPGSPVLMNMGTFAVLTIGAAYGARLGLTTIMGYMIIGALGFDIFQSSTAELNGIEYMMGSTGGYLVGYVMATVLLGALAQRGWDRSMVWMAVAMLIGNIVLYVPGLLWLGQLYGWDQPILAWGLTPFLLGDALKLLLAAILLPLVWKLVGDARR q92ri3_rhime Biotin transporter bioB SMc00964 protein protein sinorhizobium melilo Rhizobium meliloti (strain 1021) (Ensifer meliloti) Sinorhizobium meliloti Ensifer meliloti MNTRDLVLVALFTAIIVVLGLVPPITLGFIPVPITAQSMGVMLAGCIIGAKRGALAFLLLVLLVAIGLPVLSGGRGGLAVLAGPSGGFIFGWAVAAFVTGLIAERFVKPATSEARQFAGFFLASVLGGIVVLYGIGVPWLSAVTGTPLAAAATGSLVFIPGDLLKAAIATLAARAVYAGYPLLPARV q5lr30_ruepo Biotin transporter SPO2302 protein protein ruepo Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) Silicibacter pomeroyi MSMTVLADAIGPREGTARLAKQAVLVVLGIAALAIAAKIKVPMWPVPITMGTFAVLTLGTAYGARLGLVTMMGYLLVGALGFDVFATSSAEKFGLTYMMGGTGGYLVGYLMATVLLGALAARGWDRSFAKMALALVLANVLIYVPGLLWLGQLYGWDKPILQWGLTPFLVGDALKLVLAAVLIPGLWKLVGNARG bioy-bioy-2 1339896 not-defined-356585247 1339899 unspecified role unspecified role unspecified role unspecified role c-terminal D5ARG8-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal D5ARG8-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 q5ln73 1339896 n/a 1339900 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 a3u2l6 1339896 n/a 1339901 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 q6n716 1339896 n/a 1339902 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 bioy-3 1339896 n/a 1339903 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 q89m96 1339896 n/a 1339904 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 bioy-3 1339896 n/a 1339905 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 biob-1 1339896 n/a 1339906 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 q5lr30 1339896 n/a 1339907 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 a3tzi7 1339896 n/a 1339908 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 2 DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ xu-2014-4 in vitro In vitro crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Xu Y., Tao Y., Cheung LS., Fan C., Chen LQ., Xu S., Perry K., Frommer WB., Feng L. DIP original experiment: DIP-262329X Nature 2014 IMEx Structures of bacterial homologues of SWEET transporters in two distinct conformations. Xu Y., Tao Y., Cheung LS., Fan C., Chen LQ., Xu S., Perry K., Frommer WB., Feng L. Only protein-protein interactions imex curation mocibob-2013-1 in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Mocibob M., Ivic N., Luic M., Weygand-Durasevic I. DIP original experiment: DIP-252249X Structure (London, England : 1993) 2013 IMEx Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation. Mocibob M., Ivic N., Luic M., Weygand-Durasevic I. Only protein-protein interactions imex curation mocibob-2013-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mocibob M., Ivic N., Luic M., Weygand-Durasevic I. DIP original experiment: DIP-252241X Structure (London, England : 1993) 2013 IMEx Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation. Mocibob M., Ivic N., Luic M., Weygand-Durasevic I. Only protein-protein interactions imex curation mocibob-2013-3 in vitro In vitro aminoacylation aminoacylation assay aminoacylation predetermined predetermined participant predetermined Mocibob M., Ivic N., Luic M., Weygand-Durasevic I. DIP original experiment: DIP-252244X Structure (London, England : 1993) 2013 IMEx Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation. Mocibob M., Ivic N., Luic M., Weygand-Durasevic I. Only protein-protein interactions imex curation mocibob-2013-4 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Mocibob M., Ivic N., Luic M., Weygand-Durasevic I. DIP original experiment: DIP-252242X Structure (London, England : 1993) 2013 IMEx Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation. Mocibob M., Ivic N., Luic M., Weygand-Durasevic I. Only protein-protein interactions imex curation mocibob-2013-8 in vitro In vitro aminoacylation aminoacylation assay aminoacylation predetermined predetermined participant predetermined Mocibob M., Ivic N., Luic M., Weygand-Durasevic I. DIP original experiment: DIP-252246X Structure (London, England : 1993) 2013 IMEx Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation. Mocibob M., Ivic N., Luic M., Weygand-Durasevic I. Only protein-protein interactions imex curation mocibob-2013-9 in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Mocibob M., Ivic N., Luic M., Weygand-Durasevic I. DIP original experiment: DIP-252248X Structure (London, England : 1993) 2013 IMEx Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation. Mocibob M., Ivic N., Luic M., Weygand-Durasevic I. Only protein-protein interactions imex curation srivastava-2010-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Srivastava D., Schuermann JP., White TA., Krishnan N., Sanyal N., Hura GL., Tan A., Henzl MT., Becker DF., Tanner JJ. DIP original experiment: DIP-216027X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of the bifunctional proline utilization A flavoenzyme from Bradyrhizobium japonicum. Srivastava D., Schuermann JP., White TA., Krishnan N., Sanyal N., Hura GL., Tan A., Henzl MT., Becker DF., Tanner JJ. Only protein-protein interactions imex curation srivastava-2010-2 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Srivastava D., Schuermann JP., White TA., Krishnan N., Sanyal N., Hura GL., Tan A., Henzl MT., Becker DF., Tanner JJ. DIP original experiment: DIP-216028X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of the bifunctional proline utilization A flavoenzyme from Bradyrhizobium japonicum. Srivastava D., Schuermann JP., White TA., Krishnan N., Sanyal N., Hura GL., Tan A., Henzl MT., Becker DF., Tanner JJ. Only protein-protein interactions imex curation srivastava-2010-3 ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Srivastava D., Schuermann JP., White TA., Krishnan N., Sanyal N., Hura GL., Tan A., Henzl MT., Becker DF., Tanner JJ. DIP original experiment: DIP-216029X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of the bifunctional proline utilization A flavoenzyme from Bradyrhizobium japonicum. Srivastava D., Schuermann JP., White TA., Krishnan N., Sanyal N., Hura GL., Tan A., Henzl MT., Becker DF., Tanner JJ. Only protein-protein interactions imex curation q89e26_bradu Bifunctional protein PutA putA protein protein braja Bradyrhizobium japonicum (strain USDA 110) MPNIPPPFTAPYAPDDAEIAARLLPASHLSPPQEARIHRTATRLIEAIRKRDDRLGGVEDMLREFALSTKEGLALMVLAEALLRVPDARTADQFIEDKLGEGDFIHHETKSTAFLVNASAWALGLSARVIQPGETPDGTIGRLVKRLGAPAVRTATRQAMRLMGNHFVLGETIEQALERGKPRSGQKTRYSFDMLGEGARTAADARRYFDAYASAIETIGKAAGNHALPDRPGISVKLSALHPRFEAISRARVMVELVPQLLDLAQRAKAHDLNFTVDAEEADRLELSLDVIAATLADPSLKGWDGFGLAIQAYQKRASAVIDYVDALARAHDRKLMVRLVKGAYWDTEIKRAQERGLDGYPVFTRKAMTDLNYVACASKLLALRPRIFPQFATHNALTVATVLEMAEGSSGFEFQRLHGMGEALYEQLAKDHADIAYRTYAPVGSHRDLLAYLVRRLLENGANSSFVAQAADYRVPVPALLQRPADAIVRPQAAAHPRIPLPCDLFAPERRNSRGVEFGARTALDQLLTDVKAETGDLKPIADATPDQAHAAVAAARAGFAGWSRTPAGIRAAALEQAAHLLESRSAHFIALLQREGGKTLDDALSELREAADFCRYYAAQGRKLFGSETAMPGPTGESNALTMRGRGVFVAISPWNFPLAIFLGQVTAALMAGNSVVAKPAEQTPRIAREAVALLHEAGIPKSALYLVTGDGRIGAALTAHPDIAGVVFTGSTEVARSINRALAAKDGPIVPLIAETGGINAMIADATALPEQVADDVVTSAFRSAGQRCSALRLLFVQEDVADRMIEMVAGAARELKIGDPSDVATHVGPVIDVEAKQRLDAHIARMKTEARLHFAGPAPEGCFVAPHIFELTEAGQLTEEVFGPILHVVRYRPENLERVLRAIERTGYGLTLGVHSRIDDSIEAIIDRVQVGNIYVNRNMIGAVVGVQPFGGNGLSGTGPKAGGPHYLARFATEQTVTINTAAAGGNAALLAGEE E9B8267EF1660875 aacp1_bradu Aminoacyl carrier protein 1 bsr0959 protein protein braja Bradyrhizobium japonicum (strain USDA 110) MQAFNTDVRNRIIKLVKGILEQNALAADVTPQAKLVDVGLTSMDMVNLMLGVEAEFDFTIPQSEITPENFQSVETLERMVMTQLQPATAA aacl1_bradu Amino acid--[acyl-carrier-protein] ligase 1 Amino acid:[carrier-protein] ligase [AMP forming] 1 Aminoacyl-[acyl-carrier-protein] synthetase 1 L-glycine:[acyl-carrier-protein] ligase 1 bll0957 protein protein braja Bradyrhizobium japonicum (strain USDA 110) MNIAVLPNSPDTAPQIADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITSHREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVCGLHGTEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSKHLDRLQSFRMREYVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASDPFFGRVGQMKAVSQKQQQLKFELLIPLRSEEQPTACMSFNYHREHFGTTWGIQDANGEPAHTGCVAFGMDRLAVAMFHTHGTDLSAWPAKVRDILGLQPHVAAGAHGEGWR aacl_agrfc Amino acid--[acyl-carrier-protein] ligase Amino acid:[carrier-protein] ligase [AMP forming] Aminoacyl-[acyl-carrier-protein] synthetase L-alanine:[acyl-carrier-protein] ligase L-glycine:[acyl-carrier-protein] ligase L-serine:[acyl-carrier-protein] ligase AGR_C_4663 Atu2573 protein protein agrt5 Agrobacterium tumefaciens (strain C58 / ATCC 33970) Agrobacterium tumefaciens (strain C58) MTVFSAIPPISCWFTGRTPASWDKTMDMQTSFLDRLFEEGLLIETGVDGLYGRSGQFEDVIAAFERLIDRTGGADGAEAIRFPPGINRAYFEKSGYMKSFPQLAGTVHSFCGCELDHVSLLKSMDEGGDWTKDQKATDIVLTPAACYPLYPTIAKRGALPAGGGLYDIQSYCFRHEPSKDPARQQLFRMREYVCMGTESDVTEFRQTWMDRGVEMMKAVGLDVTIDIANDPFFGRAGKMLANNQRDQNLKFELLIPVTSATNPTACMSFNYHQDAFGQKWGLNLENGDVAHTACVGFGLERIALALFAHHGLDVKKWPAKVVETLWG sweet_bradu Sugar transporter SemiSWEET bsr6460 protein protein braja Bradyrhizobium japonicum (strain USDA 110) MDPFLIKLIGFAAATCTTVAYAPQFIKVLKTRSARDISLGMFLVMVLGLALWLIYGLLSGDAPLIASNAVTMLLAGGILVMKLRYG sweet_bradu-1 3269613 N/A 3269618 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false aacp1_bradu-aacl1_bradu-1 3252480 N/A 3252489 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3252490 unspecified role unspecified role prey prey Region 214-219 Region 214-219 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false aacl1_bradu-aacp1_bradu-1 3252481 N/A 3252489 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3252490 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false aacl1_bradu-aacp1_bradu-2 3252482 N/A 3252489 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli N/A 3252490 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli aminoacylation aminoacylation reaction aminoacylation false false false aacl1_bradu-aacp1_bradu-3 3252483 N/A 3252489 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3252490 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false aacl_agrfc-aacp1_bradu-1 3252487 N/A 3252489 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli N/A 3252492 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli aminoacylation aminoacylation reaction aminoacylation false false false aacp1_bradu-aacl_agrfc-1 3252488 N/A 3252489 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3252492 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false puta-6 3203144 N/A 3203147 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false puta-7 3203145 N/A 3203147 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false puta-8 3203146 N/A 3203147 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint chaloupkova-2011-1 Stereoselectivity and conformational stability of haloalkane dehalogenase DbjA from Bradyrhizobium japonicum USDA110: the effect of pH and temperature. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chaloupkova R., Prokop Z., Sato Y., Nagata Y., Damborsky J. FEBS J. (1742-464X) 2011 mohorko-2012-1 Thioredoxin-like protein TlpA from Bradyrhizobium japonicum is a reductant for the copper metallochaperone ScoI. in vitro In vitro crosslink cross-linking study crosslink experimental particp experimental participant identification experimental particp Mohorko E., Abicht HK., Bühler D., Glockshuber R., Hennecke H., Fischer HM. FEBS Lett. (0014-5793) 2012 mohorko-2012-2 Thioredoxin-like protein TlpA from Bradyrhizobium japonicum is a reductant for the copper metallochaperone ScoI. in vitro In vitro oxidoreduct assay oxidoreductase assay oxidoreduct assay experimental particp experimental participant identification experimental particp Mohorko E., Abicht HK., Bühler D., Glockshuber R., Hennecke H., Fischer HM. FEBS Lett. (0014-5793) 2012 q89vb6_bradu blr1131 protein protein braja Bradyrhizobium japonicum (strain USDA 110) MSSATRPLVIATAFAASLIVGLLIMFWAMGGVGKVAQPAAIGGPFQLTDQNGKAVTDKSLKGKPTLIFFGYTHCPDVCPTSLFEISEVLRAMGKDADKVNAIFISVDPERDTPATMKNYLSSFDPHLEGLSGDPAEIAKVITSYRVYAKKVPTKDGDYTMDHTALIYLMDRDGRFVSPFNLKRTPEEAAADLKRYL mint tlpa_bradu Thiol:disulfide interchange protein TlpA tlpA Cytochrome c biogenesis protein TlpA bll1380 protein protein braja Bradyrhizobium japonicum (strain USDA 110) MLDTKPSATRRIPLVIATVAVGGLAGFAALYGLGLSRAPTGDPACRAAVATAQKIAPLAHGEVAALTMASAPLKLPDLAFEDADGKPKKLSDFRGKTLLVNLWATWCVPCRKEMPALDELQGKLSGPNFEVVAINIDTRDPEKPKTFLKEANLTRLGYFNDQKAKVFQDLKAIGRALGMPTSVLVDPQGCEIATIAGPAEWASEDALKLIRAATGKAAAAL mint dhaa_bradu Haloalkane dehalogenase dhaA blr1087 protein protein braja Bradyrhizobium japonicum (strain USDA 110) MSKPIEIEIRRAPVLGSSMAYRETGAQDAPVVLFLHGNPTSSHIWRNILPLVSPVAHCIAPDLIGFGQSGKPDIAYRFFDHVRYLDAFIEQRGVTSAYLVAQDWGTALAFHLAARRPDFVRGLAFMEFIRPMPTWQDFHHTEVAEEQDHAEAARAVFRKFRTPGEGEAMILEANAFVERVLPGGIVRKLGDEEMAPYRTPFPTPESRRPVLAFPRELPIAGEPADVYEALQSAHAALAASSYPKLLFTGEPGALVSPEFAERFAASLTRCALIRLGAGLHYLQEDHADAIGRSVAGWIAGIEAVRPQLAA mint dhaa 1154681 dhaa_braja DbjA 1154682 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 direct interaction direct interaction false false false mint f3 sf1 dhaa-1 1154681 dhaa_braja DbjA 1154682 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 4.0 direct interaction direct interaction false false false mint f3 sf1 q89vb6-tlpa 1322395 blr1131 ScoI 1322397 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified Q89VB6:p.Cys78Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false tlpa TlpA 1322398 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f3 mint q89vb6-tlpa-1 1322395 tlpa TlpA 1322398 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified blr1131 ScoI 1322397 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified Q89VB6:p.Cys74Ser mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3 mint q89vb6-tlpa-2 1322396 blr1131 ScoI 1322397 predetermined predetermined participant predetermined electron acceptor electron acceptor neutral component neutral component purified purified tlpa TlpA 1322398 predetermined predetermined participant predetermined electron donor electron donor neutral component neutral component purified purified redox reaction oxidoreductase activity electron transfer reaction redox reaction false false false f2b mint