mpidb The Microbial Protein Interaction Database sharma-2008a-2 Differential mechanisms of binding of anti-sigma factors Escherichia coli Rsd and bacteriophage T4 AsiA to E. coli RNA polymerase lead to diverse physiological consequences. in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Sharma U.K., Chatterji D. umender.sharma@astrazeneca.com J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation sharma-2008a-1 Differential mechanisms of binding of anti-sigma factors Escherichia coli Rsd and bacteriophage T4 AsiA to E. coli RNA polymerase lead to diverse physiological consequences. ecoli Escherichia coli (strain K12) pull down pull down weight by staining molecular weight estimation by staining weight by staining Sharma U.K., Chatterji D. umender.sharma@astrazeneca.com J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation sharma-2008a-3 Differential mechanisms of binding of anti-sigma factors Escherichia coli Rsd and bacteriophage T4 AsiA to E. coli RNA polymerase lead to diverse physiological consequences. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sharma U.K., Chatterji D. umender.sharma@astrazeneca.com J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation rpod_ecoli RNA polymerase sigma factor RpoD rpoD alt b3067 Sigma-70 JW3039 protein protein ecoli Escherichia coli (strain K12) MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAPDADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPTATHVGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKAKGRSHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKMPKKNFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESLRAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD rsd_ecoli Regulator of sigma D rsd b3995 JW3959 protein protein ecoli Escherichia coli (strain K12) MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA asia_bpt4 10 kDa anti-sigma factor 10 kDa RNA polymerase-associated protein asiA Audrey Stevens' inhibitor protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MNKNIDTVREIITVASILIKFSREDIVENRANFIAFLNEIGVTHEGRKLNQNSFRKIVSELTQEDKKTLIDEFNEGFEGVYRYLEMYTNK rpoa_ecoli DNA-directed RNA polymerase subunit alpha rpoA pez phs sez b3295 Transcriptase subunit alpha RNA polymerase subunit alpha JW3257 protein protein ecoli Escherichia coli (strain K12) MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVEIDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGDVEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPVERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQPEVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE rpob_ecoli DNA-directed RNA polymerase subunit beta rpoB groN nitB rif ron stl stv tabD b3987 Transcriptase subunit beta RNA polymerase subunit beta JW3950 protein protein ecoli Escherichia coli (strain K12) MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKDYIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRLSALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGILSKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVTDEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKRGGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDLSEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDELKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAKLREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLKLGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMPESFNVLLKEIRSLGINIELEDE rsd-rpod-3 1333244 not-defined-1592777640 1333247 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) not-defined-1368382543 1333248 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 4B asia-rpoa-1 1333244 n/a 1333249 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1333250 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1333247 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1333251 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) association association false false false Fig. 4A asia-rpoa-3 1333244 n/a 1333249 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1333247 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) association association false false false Fig. 6C rsd-rpod 1333245 not-defined-878608212 1333248 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1785403039 1333247 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3B asia-rpoa 1333245 n/a 1333250 unspecified role unspecified role prey prey n/a 1333251 unspecified role unspecified role prey prey n/a 1333247 unspecified role unspecified role prey prey n/a 1333249 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 3B rpod-rsd-2 1333246 not-defined-214177421 1333248 unspecified role unspecified role prey prey n/a 1333247 unspecified role unspecified role bait bait physical association physical association false false false Fig. 6A rpod-asia-2 1333246 n/a 1333249 unspecified role unspecified role prey prey n/a 1333247 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 6A IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tao-1997-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tao Y., Strelkov SV., Mesyanzhinov VV., Rossmann MG. mgr@indiana.bio.purdue.edu Structure (London, England : 1993) 1997 Only protein-protein interactions imex curation imex curation kanamaru-2005-1 Control of bacteriophage T4 tail lysozyme activity during the infection process. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kanamaru S., Ishiwata Y., Suzuki T., Rossmann MG., Arisaka F. PDBe - Data obtained from the Protein Data Bank Europe skanamar@bio.titech.ac.jp J. Mol. Biol. (0022-2836) 2005 dove-2001-1 Bacterial two-hybrid analysis of interactions between region 4 of the sigma(70) subunit of RNA polymerase and the transcriptional regulators Rsd from Escherichia coli and AlgQ from Pseudomonas aeruginosa. ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Dove SL., Hochschild A. The transcriptional complementation was studied with proteins fused to alpha RNAP (bait) and lambda CI (prey). ahochschild@hms.harvard.edu J. Bacteriol. (0021-9193) 2001 Only protein-protein interactions imex curation rpod_pseae RNA polymerase sigma factor RpoD rpoD rpoDA Sigma-70 PA0576 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MSGKAQQQSRLKELIARGREQGYLTYAEVNDHLPEDISDPEQVEDIIRMINDMGINVFETAPDADALLLAEADTDEAAAEEAAAALAAVESDIGRTTDPVRMYMREMGTVELLTREGEIEIAKRIEEGIREVMSAIAQFPGTVDSILADYNRIVAEGGRLSDVLSGYIDPDDGSLPAEEVEPVNLKDDSADSKEKDDEEEESDDSSDSDDEGDGGPDPEEARLRFTAVSEQLDKAKKALKKHGRGSKQATAELTGLAELFMPIKLVPKQFDALVARVRSALEGVRAQERAIMQLCVRDARMPRADFLRLFPNHETDEKWVDSVLKSKPKYAEAIERLRDDILRNQQKLAALESEVELTVAEIKEINRAMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELGERMDMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDSTMQSPIEMATSESLKESTREVLAGLTAREAKVLRMRFGIDMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEHLRSFLDE rpod_ecoli RNA polymerase sigma factor RpoD rpoD alt b3067 Sigma-70 JW3039 protein protein ecoli Escherichia coli (strain K12) MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAPDADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPTATHVGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKAKGRSHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKMPKKNFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESLRAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD rsd_ecoli Regulator of sigma D rsd b3995 JW3959 protein protein ecoli Escherichia coli (strain K12) MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA asia_bpt4 10 kDa anti-sigma factor 10 kDa RNA polymerase-associated protein asiA Audrey Stevens' inhibitor protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MNKNIDTVREIITVASILIKFSREDIVENRANFIAFLNEIGVTHEGRKLNQNSFRKIVSELTQEDKKTLIDEFNEGFEGVYRYLEMYTNK algq_pseae Transcriptional regulatory protein AlgQ algQ algR2 Alginate regulatory protein AlgR2 PA5255 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MLESCRNAQERWGGVHQLIDRWLHERQQLVQAFDALSGIQAPAPNAEELQHFCQLLLDYVSAGHFEVYEQLTAEGKAFGDQRGLELAKQIFPRLEAITESALNFNDRCDNGDCREGACLIAELKVLRQQLHERFELEDCLIEVLHNAHSQSGAEGSAVPV wac_bpt4 Fibritin wac Collar protein Whisker antigen control protein protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MTDIVLNDLPFVDGPPAEGQSRISWIKNGEEILGADTQYGSEGSMNRPTVSVLRNVEVLDKNIGILKTSLETANSDIKTIQGILDVSGDIEALAQIGINKKDISDLKTLTSEHTEILNGTNNTVDSILADIGPFNAEANSVYRTIRNDLLWIKRELGQYTGQDINGLPVVGNPSSGMKHRIINNTDVITSQGIRLSELETKFIESDVGSLTIEVGNLREELGPKPPSFSQNVYSRLNEIDTKQTTVESDISAIKTSIGYPGNNSIITSVNTNTDNIASINLELNQSGGIKQRLTVIETSIGSDDIPSSIKGQIKDNTTSIESLNGIVGENTSSGLRANVSWLNQIVGTDSSGGQPSPPGSLLNRVSTIETSVSGLNNAVQNLQVEIGNNSAGIKGQVVALNTLVNGTNPNGSTVEERGLTNSIKANETNIASVTQEVNTAKGNISSLQGDVQALQEAGYIPEAPRDGQAYVRKDGEWVFLSTFLSPA bp27_bpt4 Baseplate central spike complex protein gp27 27 Hub protein 27 Gene product 27 protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MSMLQRPGYPNLSVKLFDSYDAWSNNRFVELAATITTLTMRDSLYGRNEGMLQFYDSKNIHTKMDGNEIIQISVANANDINNVKTRIYGCKHFSVSVDSKGDNIIAIELGTIHSIENLKFGRPFFPDAGESIKEMLGVIYQDRTLLTPAINAINAYVPDIPWTSTFENYLSYVREVALAVGSDKFVFVWQDIMGVNMMDYDMMINQEPYPMIVGEPSLIGQFIQELKYPLAYDFVWLTKSNPHKRDPMKNATIYAHSFLDSSIPMITTGKGENSIVVSRSGAYSEMTYRNGYEEAIRLQTMAQYDGYAKCSTIGNFNLTPGVKIIFNDSKNQFKTEFYVDEVIHELSNNNSVTHLYMFTNATKLETIDPVKVKNEFKSDTTTEESSSSNKQ needl_bpt4 Pre-baseplate central spike protein Gp5 5 Peptidoglycan hydrolase gp5 protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MEMISNNLNWFVGVVEDRMDPLKLGRVRVRVVGLHPPQRAQGDVMGIPTEKLPWMSVIQPITSAAMSGIGGSVTGPVEGTRVYGHFLDKWKTNGIVLGTYGGIVREKPNRLEGFSDPTGQYPRRLGNDTNVLNQGGEVGYDSSSNVIQDSNLDTAINPDDRPLSEIPTDDNPNMSMAEMLRRDEGLRLKVYWDTEGYPTIGIGHLIMKQPVRDMAQINKVLSKQVGREITGNPGSITMEEATTLFERDLADMQRDIKSHSKVGPVWQAVNRSRQMALENMAFQMGVGGVAKFNTMLTAMLAGDWEKAYKAGRDSLWYQQTKGRASRVTMIILTGNLESYGVEVKTPARSLSAMAATVAKSSDPADPPIPNDSRILFKEPVSSYKGEYPYVHTMETESGHIQEFDDTPGQERYRLVHPTGTYEEVSPSGRRTRKTVDNLYDITNADGNFLVAGDKKTNVGGSEIYYNMDNRLHQIDGSNTIFVRGDETKTVEGNGTILVKGNVTIIVEGNADITVKGDATTLVEGNQTNTVNGNLSWKVAGTVDWDVGGDWTEKMASMSSISSGQYTIDGSRIDIG wac-1 3582636 N/A 3582637 unspecified role unspecified role neutral component neutral component purified purified fibritin E sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 3.0 direct interaction direct interaction false false false Fig.2 and fig.3 Rwork = 0.216 Rfree = 0.259 2.2 Å 27-5-2 Crystal structure of gp5-s351l mutant and gp27 complex 515645 N/A 515646 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 515647 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false hexameric, multimeric working 78.300%, free 71.900% 2.8A rpod-rsd 770668 n/a 770669 unspecified role unspecified role prey prey lambda ci tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 770670 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P00579:p.Arg596His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false alpha tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 1 rpod-rsd-1 770668 n/a 770669 unspecified role unspecified role prey prey lambda ci tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 770671 unspecified role unspecified role bait bait alpha rnap tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P26480:p.Arg600His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5A rpod-algq 770668 n/a 770670 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false alpha tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P00579:p.Arg596His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n/a 770672 unspecified role unspecified role prey prey lambda ci tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 5B rpod-algq-1 770668 n/a 770672 unspecified role unspecified role prey prey lambda ci tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 770671 unspecified role unspecified role bait bait P26480:p.Arg600His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false alpha rnap tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3 rpod-asia 770668 n/a 770670 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false alpha tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P00579:p.Arg596His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n/a 770673 unspecified role unspecified role prey prey lambda ci tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 6 rpod-asia-1 770668 n/a 770673 unspecified role unspecified role prey prey lambda ci tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 770671 unspecified role unspecified role bait bait alpha rnap tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P26480:p.Arg600His mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 6 MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kanamaru-2002-1 Structure of the cell-puncturing device of bacteriophage T4. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kanamaru S., Leiman PG., Kostyuchenko VA., Chipman PR., Mesyanzhinov VV., Arisaka F., Rossmann MG. PDBe - Data obtained from the Protein Data Bank Europe Nature (0028-0836) 2002 needl_bpt4 Pre-baseplate central spike protein Gp5 5 Peptidoglycan hydrolase gp5 protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MEMISNNLNWFVGVVEDRMDPLKLGRVRVRVVGLHPPQRAQGDVMGIPTEKLPWMSVIQPITSAAMSGIGGSVTGPVEGTRVYGHFLDKWKTNGIVLGTYGGIVREKPNRLEGFSDPTGQYPRRLGNDTNVLNQGGEVGYDSSSNVIQDSNLDTAINPDDRPLSEIPTDDNPNMSMAEMLRRDEGLRLKVYWDTEGYPTIGIGHLIMKQPVRDMAQINKVLSKQVGREITGNPGSITMEEATTLFERDLADMQRDIKSHSKVGPVWQAVNRSRQMALENMAFQMGVGGVAKFNTMLTAMLAGDWEKAYKAGRDSLWYQQTKGRASRVTMIILTGNLESYGVEVKTPARSLSAMAATVAKSSDPADPPIPNDSRILFKEPVSSYKGEYPYVHTMETESGHIQEFDDTPGQERYRLVHPTGTYEEVSPSGRRTRKTVDNLYDITNADGNFLVAGDKKTNVGGSEIYYNMDNRLHQIDGSNTIFVRGDETKTVEGNGTILVKGNVTIIVEGNADITVKGDATTLVEGNQTNTVNGNLSWKVAGTVDWDVGGDWTEKMASMSSISSGQYTIDGSRIDIG bp27_bpt4 Baseplate central spike complex protein gp27 27 Hub protein 27 Gene product 27 protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MSMLQRPGYPNLSVKLFDSYDAWSNNRFVELAATITTLTMRDSLYGRNEGMLQFYDSKNIHTKMDGNEIIQISVANANDINNVKTRIYGCKHFSVSVDSKGDNIIAIELGTIHSIENLKFGRPFFPDAGESIKEMLGVIYQDRTLLTPAINAINAYVPDIPWTSTFENYLSYVREVALAVGSDKFVFVWQDIMGVNMMDYDMMINQEPYPMIVGEPSLIGQFIQELKYPLAYDFVWLTKSNPHKRDPMKNATIYAHSFLDSSIPMITTGKGENSIVVSRSGAYSEMTYRNGYEEAIRLQTMAQYDGYAKCSTIGNFNLTPGVKIIFNDSKNQFKTEFYVDEVIHELSNNNSVTHLYMFTNATKLETIDPVKVKNEFKSDTTTEESSSSNKQ 27-5-1 The structure of the bacteriophage t4 cell-puncturing device 99825 N/A 99826 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 99827 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false hexameric, multimeric working 78.900%, free 72.00% 2.9A DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ biertmpfel-2007-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Biertümpfel C., Yang W., Suck D. DIP original experiment: DIP-253070X Nature 2007 IMEx Crystal structure of T4 endonuclease VII resolving a Holliday junction. Biertümpfel C., Yang W., Suck D. Only protein-protein interactions imex curation aksyuk-2009-1 ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Aksyuk AA., Leiman PG., Shneider MM., Mesyanzhinov VV., Rossmann MG. DIP original experiment: DIP-132038X Structure (London, England : 1993) 2009 IMEx The structure of gene product 6 of bacteriophage T4, the hinge-pin of the baseplate. Aksyuk AA., Leiman PG., Shneider MM., Mesyanzhinov VV., Rossmann MG. Only protein-protein interactions imex curation aksyuk-2009-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Aksyuk AA., Leiman PG., Shneider MM., Mesyanzhinov VV., Rossmann MG. DIP original experiment: DIP-132039X Structure (London, England : 1993) 2009 IMEx The structure of gene product 6 of bacteriophage T4, the hinge-pin of the baseplate. Aksyuk AA., Leiman PG., Shneider MM., Mesyanzhinov VV., Rossmann MG. Only protein-protein interactions imex curation aksyuk-2009-3 ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Aksyuk AA., Leiman PG., Shneider MM., Mesyanzhinov VV., Rossmann MG. DIP original experiment: DIP-132040X Structure (London, England : 1993) 2009 IMEx The structure of gene product 6 of bacteriophage T4, the hinge-pin of the baseplate. Aksyuk AA., Leiman PG., Shneider MM., Mesyanzhinov VV., Rossmann MG. Only protein-protein interactions imex curation bartual-2010-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bartual SG., Otero JM., Garcia-Doval C., Llamas-Saiz AL., Kahn R., Fox GC., van Raaij MJ. DIP original experiment: DIP-220597X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Structure of the bacteriophage T4 long tail fiber receptor-binding tip. Bartual SG., Otero JM., Garcia-Doval C., Llamas-Saiz AL., Kahn R., Fox GC., van Raaij MJ. Only protein-protein interactions imex curation sun-2012-8 in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Sun S., Gao S., Kondabagil K., Xiang Y., Rossmann MG., Rao VB. DIP original experiment: DIP-253549X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure and function of the small terminase component of the DNA packaging machine in T4-like bacteriophages. Sun S., Gao S., Kondabagil K., Xiang Y., Rossmann MG., Rao VB. Only protein-protein interactions imex curation sun-2012-10 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Sun S., Gao S., Kondabagil K., Xiang Y., Rossmann MG., Rao VB. DIP original experiment: DIP-253547X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structure and function of the small terminase component of the DNA packaging machine in T4-like bacteriophages. Sun S., Gao S., Kondabagil K., Xiang Y., Rossmann MG., Rao VB. Only protein-protein interactions imex curation yuan-2009-1 ecolx Escherichia coli lambda two hybrid lambda repressor two hybrid BacterioMatch BacterioMatch lambda two hybrid predetermined predetermined participant predetermined Yuan AH., Nickels BE., Hochschild A. DIP original experiment: DIP-260242X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The bacteriophage T4 AsiA protein contacts the beta-flap domain of RNA polymerase. Yuan AH., Nickels BE., Hochschild A. Only protein-protein interactions imex curation yuan-2009-2 ecolx Escherichia coli lambda two hybrid lambda repressor two hybrid BacterioMatch BacterioMatch lambda two hybrid predetermined predetermined participant predetermined Yuan AH., Nickels BE., Hochschild A. DIP original experiment: DIP-260240X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The bacteriophage T4 AsiA protein contacts the beta-flap domain of RNA polymerase. Yuan AH., Nickels BE., Hochschild A. Only protein-protein interactions imex curation yuan-2009-3 in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Yuan AH., Nickels BE., Hochschild A. DIP original experiment: DIP-260245X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The bacteriophage T4 AsiA protein contacts the beta-flap domain of RNA polymerase. Yuan AH., Nickels BE., Hochschild A. Only protein-protein interactions imex curation yuan-2009-4 ecolx Escherichia coli lambda two hybrid lambda repressor two hybrid BacterioMatch BacterioMatch lambda two hybrid predetermined predetermined participant predetermined Yuan AH., Nickels BE., Hochschild A. DIP original experiment: DIP-260243X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx The bacteriophage T4 AsiA protein contacts the beta-flap domain of RNA polymerase. Yuan AH., Nickels BE., Hochschild A. Only protein-protein interactions imex curation twist-2011-1 ecolx Escherichia coli lambda two hybrid lambda repressor two hybrid BacterioMatch BacterioMatch lambda two hybrid predetermined predetermined participant predetermined Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. DIP original experiment: DIP-253835X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. Only protein-protein interactions imex curation twist-2011-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. DIP original experiment: DIP-253831X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. Only protein-protein interactions imex curation twist-2011-3 ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. DIP original experiment: DIP-253829X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. Only protein-protein interactions imex curation twist-2011-6 ecolx Escherichia coli lambda two hybrid lambda repressor two hybrid BacterioMatch BacterioMatch lambda two hybrid predetermined predetermined participant predetermined Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. DIP original experiment: DIP-253832X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. Only protein-protein interactions imex curation twist-2011-7 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. DIP original experiment: DIP-253830X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx Crystal structure of the bacteriophage T4 late-transcription coactivator gp33 with the β-subunit flap domain of Escherichia coli RNA polymerase. Twist KA., Campbell EA., Deighan P., Nechaev S., Jain V., Geiduschek EP., Hochschild A., Darst SA. Only protein-protein interactions imex curation clare-2009-1 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Clare DK., Bakkes PJ., van Heerikhuizen H., van der Vies SM., Saibil HR. DIP original experiment: DIP-249748X Nature 2009 IMEx Chaperonin complex with a newly folded protein encapsulated in the folding chamber. Clare DK., Bakkes PJ., van Heerikhuizen H., van der Vies SM., Saibil HR. Only protein-protein interactions imex curation clare-2009-2 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Clare DK., Bakkes PJ., van Heerikhuizen H., van der Vies SM., Saibil HR. DIP original experiment: DIP-249749X Nature 2009 IMEx Chaperonin complex with a newly folded protein encapsulated in the folding chamber. Clare DK., Bakkes PJ., van Heerikhuizen H., van der Vies SM., Saibil HR. Only protein-protein interactions imex curation rpob_ecoli DNA-directed RNA polymerase subunit beta rpoB groN nitB rif ron stl stv tabD b3987 Transcriptase subunit beta RNA polymerase subunit beta JW3950 protein protein ecoli Escherichia coli (strain K12) MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKDYIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRLSALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGILSKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVTDEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKRGGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDLSEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDELKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAKLREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLKLGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMPESFNVLLKEIRSLGINIELEDE asia_bpt4 10 kDa anti-sigma factor 10 kDa RNA polymerase-associated protein asiA Audrey Stevens' inhibitor protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MNKNIDTVREIITVASILIKFSREDIVENRANFIAFLNEIGVTHEGRKLNQNSFRKIVSELTQEDKKTLIDEFNEGFEGVYRYLEMYTNK rpod_ecoli RNA polymerase sigma factor RpoD rpoD alt b3067 Sigma-70 JW3039 protein protein ecoli Escherichia coli (strain K12) MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAPDADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPTATHVGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKAKGRSHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKMPKKNFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESLRAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD ch60_ecoli Chaperonin GroEL groEL 60 kDa chaperonin Chaperonin-60 GroEL protein groL mopA JW4103 b4143 protein protein ecoli Escherichia coli (strain K12) MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALIRVASKLADLRGQNEDQNVGIKVALRAMEAPLRQIVLNCGEEPSVVANTVKGGDGNYGYNAATEEYGNMIDMGILDPTKVTRSALQYAASVAGLMITTECMVTDLPKNDAADLGAAGGMGGMGGMGGMM CD3A0FB505F74AD1 capsh_bpt4 Major capsid protein gp23 Gene product 23 Major head protein gp23 protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MTIKTKAELLNKWKPLLEGEGLPEIANSKQAIIAKIFENQEKDFQTAPEYKDEKIAQAFGSFLTEAEIGGDHGYNATNIAAGQTSGAVTQIGPAVMGMVRRAIPNLIAFDICGVQPMNSPTGQVFALRAVYGKDPVAAGAKEAFHPMYGPDAMFSGQGAAKKFPALAASTQTTVGDIYTHFFQETGTVYLQASVQVTIDAGATDAAKLDAEIKKQMEAGALVEIAEGMATSIAELQEGFNGSTDNPWNEMGFRIDKQVIEAKSRQLKAAYSIELAQDLRAVHGMDADAELSGILATEIMLEINREVVDWINYSAQVGKSGMTLTPGSKAGVFDFQDPIDIRGARWAGESFKALLFQIDKEAVEIARQTGRGEGNFIIASRNVVNVLASVDTGISYAAQGLATGFSTDTTKSVFAGVLGGKYRVYIDQYAKQDYFTVGYKGPNEMDAGIYYAPYVALTPLRGSDPKNFQPVMGFKTRYGIGINPFAESAAQAPASRIQSGMPSILNSLGKNAYFRRVYVKGI vg31_bpt4 Capsid assembly protein Gp31 31 protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MSEVQQLPIRAVGEYVILVSEPAQAGDEEVTESGLIIGKRVQGEVPELCVVHSVGPDVPEGFCEVGDLTSLPVGQIRNVPHPFVALGLKQPKEIKQKFVTCHYKAIPCLYK ltact_bpt4 Late transcription coactivator Gene product 33 RNA polymerase-associated protein Gp33 33 protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MTQFSLNDIRPVDETGLSEKELSIKKEKDEIAKLLDRQENGFIIEKMVEEFGMSYLEATTAFLEENSIPETQFAKFIPSGIIEKIQSEAIDENLLRPSVVRCEKTNTLDFLL bp06_bpt4 Baseplate wedge protein gp6 6 Gene product 6 protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MANTPVNYQLTRTANAIPEIFVGGTFAEIKQNLIEWLNGQNEFLDYDFEGSRLNVLCDLLAYNTLYIQQFGNAAVYESFMRTANLRSSVVQAAQDNGYLPTSKSAAQTEIMLTCTDALNRNYITIPRGTRFLAYAKDTSVNPYNFVSREDVIAIRDKNNQYFPRLKLAQGRIVRTEIIYDKLTPIIIYDKNIDRNQVKLYVDGAEWINWTRKSMVHAGSTSTIYYMRETIDGNTEFYFGEGEISVNASEGALTANYIGGLKPTQNSTIVIEYISTNGADANGAVGFSYADTLTNITVININENPNDDPDFVGADGGGDPEDIERIRELGTIKRETQQRCVTATDYDTFVSERFGSIIQAVQTFTDSTKPGYAFIAAKPKSGLYLTTVQREDIKNYLKDYNLAPITPSIISPNYLFIKTNLKVTYALNKLQESEQWLEGQIIDKIDRYYTEDVEIFNSSFAKSKMLTYVDDADHSVIGSSATIQMVREVQNFYKTPEAGIKYNNQIKDRSMESNTFSFNSGRKVVNPDTGLEEDVLYDVRIVSTDRDSKGIGKVIIGPFASGDVTENENIQPYTGNDFNKLANSDGRDKYYVIGEINYPADVIYWNIAKINLTSEKFEVQTIELYSDPTDDVIFTRDGSLIVFENDLRPQYLTIDLEPISQ fib37_bpt4 Long-tail fiber protein gp37 37 Gene product 37 Receptor-recognizing protein protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MATLKQIQFKRSKIAGTRPAASVLAEGELAINLKDRTIFTKDDSGNIIDLGFAKGGQVDGNVTINGLLRLNGDYVQTGGMTVNGPIGSTDGVTGKIFRSTQGSFYARATNDTSNAHLWFENADGTERGVIYARPQTTTDGEIRLRVRQGTGSTANSEFYFRSINGGEFQANRILASDSLVTKRIAVDTVIHDAKAFGQYDSHSLVNYVYPGTGETNGVNYLRKVRAKSGGTIYHEIVTAQTGLADEVSWWSGDTPVFKLYGIRDDGRMIIRNSLALGTFTTNFPSSDYGNVGVMGDKYLVLGDTVTGLSYKKTGVFDLVGGGYSVASITPDSFRSTRKGIFGRSEDQGATWIMPGTNAALLSVQTQADNNNAGDGQTHIGYNAGGKMNHYFRGTGQMNINTQQGMEINPGILKLVTGSNNVQFYADGTISSIQPIKLDNEIFLTKSNNTAGLKFGAPSQVDGTRTIQWNGGTREGQNKNYVIIKAWGNSFNATGDRSRETVFQVSDSQGYYFYAHRKAPTGDETIGRIEAQFAGDVYAKGIIANGNFRVVGSSALAGNVTMSNGLFVQGGSSITGQVKIGGTANALRIWNAEYGAIFRRSESNFYIIPTNQNEGESGDIHSSLRPVRIGLNDGMVGLGRDSFIVDQNNALTTINSNSRINANFRMQLGQSAYIDAECTDAVRPAGAGSFASQNNEDVRAPFYMNIDRTDASAYVPILKQRYVQGNGCYSLGTLINNGNFRVHYHGGGDNGSTGPQTADFGWEFIKNGDFISPRDLIAGKVRFDRTGNITGGSGNFANLNSTIESLKTDIMSSYPIGAPIPWPSDSVPAGFALMEGQTFDKSAYPKLAVAYPSGVIPDMRGQTIKGKPSGRAVLSAEADGVKAHSHSASASSTDLGTKTTSSFDYGTKGTNSTGGHTHSGSGSTSTNGEHSHYIEAWNGTGVGGNKMSSYAISYRAGGSNTNAAGNHSHTFSFGTSSAGDHSHSVGIGAHTHTVAIGSHGHTITVNSTGNTENTVKNIAFNYIVRLA ters_bpt4 Terminase, small subunit 16 Gene product 16 Packaging protein Gp16 protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MEGLDINKLLDISDLPGIDGEEIKVYEPLQLVEVKSNPQNRTPDLEDDYGVVRRNMHFQQQMLMDAAKIFLETAKNADSPRHMEVFATLMGQMTTTNREILKLHKDMKDITSEQVGTKGAVPTGQMNIQNATVFMGSPTELMDEIGDAYEAQEAREKVINGTTD terl_bpt4 Terminase, large subunit 17 Gene product 17 DNA-packaging protein protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MEQPINVLNDFHPLNEAGKILIKHPSLAERKDEDGIHWIKSQWDGKWYPEKFSDYLRLHKIVKIPNNSDKPELFQTYKDKNNKRSRYMGLPNLKRANIKTQWTREMVEEWKKCRDDIVYFAETYCAITHIDYGVIKVQLRDYQRDMLKIMSSKRMTVCNLSRQLGKTTVVAIFLAHFVCFNKDKAVGILAHKGSMSAEVLDRTKQAIELLPDFLQPGIVEWNKGSIELDNGSSIGAYASSPDAVRGNSFAMIYIDECAFIPNFHDSWLAIQPVISSGRRSKIIITTTPNGLNHFYDIWTAAVEGKSGFEPYTAIWNSVKERLYNDEDIFDDGWQWSIQTINGSSLAQFRQEHTAAFEGTSGTLISGMKLAVMDFIEVTPDDHGFHQFKKPEPDRKYIATLDCSEGRGQDYHALHIIDVTDDVWEQVGVLHSNTISHLILPDIVMRYLVEYNECPVYIELNSTGVSVAKSLYMDLEYEGVICDSYTDLGMKQTKRTKAVGCSTLKDLIEKDKLIIHHRATIQEFRTFSEKGVSWAAEEGYHDDLVMSLVIFGWLSTQSKFIDYADKDDMRLASEVFSKELQDMSDDYAPVIFVDSVHSAEYVPVSHGMSMV p13340-1 Recombination endonuclease VII 49 Gene product 49 protein protein bpt4 Enterobacteria phage T4 Bacteriophage T4 MLLTGKLYKEEKQKFYDAQNGKCLICQRELNPDVQANHLDHDHELNGPKAGKVRGLLCNLCNAAEGQMKHKFNRSGLKGQGVDYLEWLENLLTYLKSDYTQNNIHPNFVGDKSKEFSRLGKEEMMAEMLQRGFEYNESDTKTQLIASFKKQLRKSLK 49-1 3161313 N/A 3161314 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false 6-1 3192518 N/A 3192521 unspecified role unspecified role unspecified role unspecified role Region 334-660 Region 334-660 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false 6-2 3192519 N/A 3192521 unspecified role unspecified role unspecified role unspecified role Region 334-660 Region 334-660 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false 6-3 3192520 N/A 3192521 unspecified role unspecified role unspecified role unspecified role Region 334-660 Region 334-660 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli covalent binding covalent binding false false false 37-1 3217207 N/A 3217208 unspecified role unspecified role unspecified role unspecified role Region 785-1026 Region 785-1026 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false 16-17 3234680 N/A 3234684 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3234685 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false 16-4 3234682 N/A 3234685 unspecified role unspecified role unspecified role unspecified role Region 1-41 Region 1-41 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Region 119-164 Region 119-164 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false asia-rpob-1 3186973 N/A 3186979 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3186980 unspecified role unspecified role bait bait P32267:p.Asn74Asp N74D mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false asia-rpob-2 3186974 N/A 3186979 unspecified role unspecified role prey prey Region 900-909 Region 900-909 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P0A8V2:p.Gly907Lys G907K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false P0A8V2:p.[Ile905Ala;Phe906Ala] I905A/F906A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3186980 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false asia-rpod-1 3186975 N/A 3186981 unspecified role unspecified role unspecified role unspecified role P00579:p.Phe563Tyr F563Y mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3186980 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false asia-rpod-2 3186976 N/A 3186981 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3186980 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false rpob-33 3233318 N/A 3186979 unspecified role unspecified role bait bait Beta-flap domain Region 858-946 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3233326 unspecified role unspecified role prey prey P13338:p.Glu70Lys E70K mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false 33-rpob-1 3233319 N/A 3186979 unspecified role unspecified role unspecified role unspecified role Beta-flap domain Region 831-1057 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3233326 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false 33-rpob-2 3233320 N/A 3186979 unspecified role unspecified role prey prey Beta-flap domain Region 831-1057 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3233326 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false rpob-3 3233323 N/A 3186979 unspecified role unspecified role bait bait Beta-flap domain Region 858-946 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P0A8V2:p.Glu898Ala E898A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P0A8V2:p.Glu899Ala E899A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P0A8V2:p.Lys900Ala K900A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P0A8V2:p.Leu901Ala L901A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P0A8V2:p.Leu902Ala L902A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P0A8V2:p.Arg903Ala R903A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P0A8V2:p.Ile905Ala I905A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P0A8V2:p.Phe906Ala F906A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P0A8V2:p.Lys900Glu K900E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3233326 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false 33-rpob-3 3233324 N/A 3186979 unspecified role unspecified role unspecified role unspecified role Beta-flap domain Region 831-1057 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3233326 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false gp23-grol-1 3182273 N/A 3182275 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3182276 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false 31-gp23-1 3182274 N/A 3182277 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3182275 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3182276 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false