DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mller-2008-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Müller JJ., Barbirz S., Heinle K., Freiberg A., Seckler R., Heinemann U. DIP original experiment: DIP-68446X Structure (London, England : 1993) 2008 IMEx An intersubunit active site between supercoiled parallel beta helices in the trimeric tailspike endorhamnosidase of Shigella flexneri Phage Sf6. Müller JJ., Barbirz S., Heinle K., Freiberg A., Seckler R., Heinemann U. Only protein-protein interactions imex curation zhao-2010-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhao H., Finch CJ., Sequeira RD., Johnson BA., Johnson JE., Casjens SR., Tang L. DIP original experiment: DIP-215943X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of the DNA-recognition component of the bacterial virus Sf6 genome-packaging machine. Zhao H., Finch CJ., Sequeira RD., Johnson BA., Johnson JE., Casjens SR., Tang L. Only protein-protein interactions imex curation zhao-2010-5 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Zhao H., Finch CJ., Sequeira RD., Johnson BA., Johnson JE., Casjens SR., Tang L. DIP original experiment: DIP-215944X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of the DNA-recognition component of the bacterial virus Sf6 genome-packaging machine. Zhao H., Finch CJ., Sequeira RD., Johnson BA., Johnson JE., Casjens SR., Tang L. Only protein-protein interactions imex curation zhao-2010-6 ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Zhao H., Finch CJ., Sequeira RD., Johnson BA., Johnson JE., Casjens SR., Tang L. DIP original experiment: DIP-215945X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of the DNA-recognition component of the bacterial virus Sf6 genome-packaging machine. Zhao H., Finch CJ., Sequeira RD., Johnson BA., Johnson JE., Casjens SR., Tang L. Only protein-protein interactions imex curation zhao-2010-7 ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds weight by staining molecular weight estimation by staining weight by staining Zhao H., Finch CJ., Sequeira RD., Johnson BA., Johnson JE., Casjens SR., Tang L. DIP original experiment: DIP-215946X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Crystal structure of the DNA-recognition component of the bacterial virus Sf6 genome-packaging machine. Zhao H., Finch CJ., Sequeira RD., Johnson BA., Johnson JE., Casjens SR., Tang L. Only protein-protein interactions imex curation q716h4_bpsfv 1 protein protein bpsfv Shigella phage Sf6 Shigella flexneri bacteriophage VI Bacteriophage SfVI MATEPKAGRPSDYMPEVADDICSLLSSGESLLKVCKRPGMPDKSTVFRWLAKHEDFRDKYAKATEARADSIFEEIFEIADNAIPDAAEVAKARLRVDTRKWALARMNPRKYGDKVTNELVGKDGGAIQIETSPMSTLFGK fiber_bpsfv Tail spike protein Endo-1,3-alpha-L-rhamnosidase Endorhamnosidase protein protein bpsfv Shigella phage Sf6 Shigella flexneri bacteriophage VI Bacteriophage SfVI MTDIITNVVIGMPSQLFTMARSFKAVANGKIYIGKIDTDPVNPENQIQVYVENEDGSHVPASQPIVINAAGYPVYNGQIVKFVTEQGHSMAVYDAYGSQQFYFQNVLKYDPDQFGPDLIEQLAQSGKYSQDNTKGDAMIGVKQPLPKAVLRTQHDKNKEAISILDFGVIDDGVTDNYQAIQNAIDAVASLPSGGELFIPASNQAVGYIVGSTLLIPGGVNIRGVGKASQLRAKSGLTGSVLRLSYDSDTIGRYLRNIRVTGNNTCNGIDTNITAEDSVIRQVYGWVFDNVMVNEVETAYLMQGLWHSKFIACQAGTCRVGLHFLGQCVSVSVSSCHFSRGNYSADESFGIRIQPQTYAWSSEAVRSEAIILDSETMCIGFKNAVYVHDCLDLHMEQLDLDYCGSTGVVIENVNGGFSFSNSWIAADADGTEQFTGIYFRTPTSTQSHKIVSGVHINTANKNTAANNQSIAIEQSAIFVFVSGCTLTGDEWAVNIVDINECVSFDKCIFNKPLRYLRSGGVSVTDCYLAGITEVQKPEGRYNTYRGCSGVPSVNGIINVPVAVGATSGSAAIPNPGNLTYRVRSLFGDPASSGDKVSVSGVTINVTRPSPVGVALPSMVEYLAI fiber_bpsfv-1 3171203 N/A 3171204 unspecified role unspecified role unspecified role unspecified role Region 110-623 Region 110-623 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false 1-117 3203789 N/A 3203793 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false 1-118 3203790 N/A 3203793 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false 1-119 3203791 N/A 3203793 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false 1-120 3203792 N/A 3203793 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false