DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mckenna-1992-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined McKenna R., Xia D., Willingmann P., Ilag LL., Krishnaswamy S., Rossmann MG., Olson NH., Baker TS., Incardona NL. DIP original experiment: DIP-263714X Nature 1992 IMEx Atomic structure of single-stranded DNA bacteriophage phi X174 and its functional implications. McKenna R., Xia D., Willingmann P., Ilag LL., Krishnaswamy S., Rossmann MG., Olson NH., Baker TS., Incardona NL. Only protein-protein interactions imex curation sun-2014-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Sun L., Young LN., Zhang X., Boudko SP., Fokine A., Zbornik E., Roznowski AP., Molineux IJ., Rossmann MG., Fane BA. DIP original experiment: DIP-259842X Nature 2014 IMEx Icosahedral bacteriophage ΦX174 forms a tail for DNA transport during infection. Sun L., Young LN., Zhang X., Boudko SP., Fokine A., Zbornik E., Roznowski AP., Molineux IJ., Rossmann MG., Fane BA. Only protein-protein interactions imex curation sun-2014-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Sun L., Young LN., Zhang X., Boudko SP., Fokine A., Zbornik E., Roznowski AP., Molineux IJ., Rossmann MG., Fane BA. DIP original experiment: DIP-259843X Nature 2014 IMEx Icosahedral bacteriophage ΦX174 forms a tail for DNA transport during infection. Sun L., Young LN., Zhang X., Boudko SP., Fokine A., Zbornik E., Roznowski AP., Molineux IJ., Rossmann MG., Fane BA. Only protein-protein interactions imex curation sun-2014-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Sun L., Young LN., Zhang X., Boudko SP., Fokine A., Zbornik E., Roznowski AP., Molineux IJ., Rossmann MG., Fane BA. DIP original experiment: DIP-259844X Nature 2014 IMEx Icosahedral bacteriophage ΦX174 forms a tail for DNA transport during infection. Sun L., Young LN., Zhang X., Boudko SP., Fokine A., Zbornik E., Roznowski AP., Molineux IJ., Rossmann MG., Fane BA. Only protein-protein interactions imex curation h_bpphs Minor spike protein H H H protein Pilot protein protein protein bpphs Enterobacteria phage phiX174 (Isolate Sanger) Bacteriophage phi-X174 MFGAIAGGIASALAGGAMSKLFGGGQKAASGGIQGDVLATDNNTVGMGDAGIKSAIQGSNVPNPDEAAPSFVSGAMAKAGKGLLEGTLQAGTSAVSDKLLDLVGLGGKSAADKGKDTRDYLAAAFPELNAWERAGADASSAGMVDAGFENQKELTKMQLDNQKEIAEMQNETQKEIAGIQSATSRQNTKDQVYAQNEMLAYQQKESTARVASIMENTNLSKQQQVSEIMRQMLTQAQTAGQYFTNDQIKEMTRKVSAEVDLVHQQTQNQRYGSSHIGATAKDISNVVTDAASGVVDIFHGIDKAVADTWNNFWKDGKADGIGSNLSRK capsd_bpphs Capsid protein F F F protein GPF protein protein bpphs Enterobacteria phage phiX174 (Isolate Sanger) Bacteriophage phi-X174 MSNIQTGAERMPHDLSHLGFLAGQIGRLITISTTPVIAGDSFEMDAVGALRLSPLRRGLAIDSTVDIFTFYVPHRHVYGEQWIKFMKDGVNATPLPTVNTTGYIDHAAFLGTINPDTNKIPKHLFQGYLNIYNNYFKAPWMPDRTEANPNELNQDDARYGFRCCHLKNIWTAPLPPETELSRQMTTSTTSIDIMGLQAAYANLHTDQERDYFMQRYHDVISSFGGKTSYDADNRPLLVMRSNLWASGYDVDGTDQTSLGQFSGRVQQTYKHSVPRFFVPEHGTMFTLALVRFPPTATKEIQYLNAKGALTYTDIAGDPVLYGNLPPREISMKDVFRSGDSSKKFKIAEGQWYRYAPSYVSPAYHLLEGFPFIQEPPSGDLQERVLIRHHDYDQCFQSVQLLQWNSQVKFNVTVYRNLPTTRDSIMTS g_bpphs Major spike protein G G G protein GPG protein protein bpphs Enterobacteria phage phiX174 (Isolate Sanger) Bacteriophage phi-X174 MFQTFISRHNSNFFSDKLVLTSVTPASSAPVLQTPKATSSTLYFDSLTVNAGNGGFLHCIQMDTSVNAANQVVSVGADIAFDADPKFFACLVRFESSSVPTTLPTAYDVYPLNGRHDGGYYTVKDCVTIDVLPRTPGNNVYVGFMVWSNFTATKCRGLVSLNQVIKEIICLQPLK j_bpphs DNA-binding protein J Small core protein J J protein protein protein bpphs Enterobacteria phage phiX174 (Isolate Sanger) Bacteriophage phi-X174 MSKGKKRSGARPGRPQPLRGTKGKRKGARLWYVGGQQF f-g-2 3136631 N/A 3136632 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3136633 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3136634 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association false false false h-7 3261131 N/A 3261134 unspecified role unspecified role unspecified role unspecified role Region 143-221 Region 143-221 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false h-8 3261132 N/A 3261134 unspecified role unspecified role unspecified role unspecified role Region 143-282 Region 143-282 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false h-9 3261133 N/A 3261134 unspecified role unspecified role unspecified role unspecified role Region 143-282 Region 143-282 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false