MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint klenner-2008-1 The Pf3 coat protein contacts TM1 and TM3 of YidC during membrane biogenesis. ecoli Escherichia coli (strain K12) crosslink cross-linking study crosslink predetermined predetermined participant predetermined Klenner C., Yuan J., Dalbey RE., Kuhn A. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2008 2008-12-03 Only protein-protein interactions imex curation capsd_bppf3 Capsid protein G8P Pf3 coat protein VIII Gene 8 protein Coat protein B Major coat protein protein protein bppf3 Pseudomonas phage Pf3 MQSVITDVTGQLTAVQADITTIGGAIIVLAAVVLGIRWIKAQFF mint yidc_ecoli Membrane protein insertase YidC Foldase YidC Inner membrane protein YidC Membrane integrase YidC Oxa1Ec JW3683 b3705 yidC protein protein ecoli Escherichia coli (strain K12) MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKLISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGPDNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNVQNAGEKPLEISSFGQLKQSITLPPHLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIADNENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQTGAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIIIITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVNPLGGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQKMSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGLHSREKKKS viii-yidc 772428 capsd_bppf3 Coat protein 772429 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P03623:p.Ile27Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false oxaa_ecoli YidC 772430 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P25714:p.Ser16Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false TM1 disulfide bond disulfide bond disulfide bridge SS-bond false false false F3 mint viii-yidc-1 772428 capsd_bppf3 Coat protein 772429 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P03623:p.Ile27Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false oxaa_ecoli YidC 772430 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false TM3 P25714:p.Met430Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false disulfide bond disulfide bond disulfide bridge SS-bond false false false F3 F4 F5 mint viii-viii 772428 capsd_bppf3 Coat protein 772429 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P03623:p.Ile27Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false capsd_bppf3 Coat protein 772429 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P03623:p.Ile27Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false disulfide bond disulfide bond disulfide bridge SS-bond false false false F3 mint viii-yidc-2 772428 capsd_bppf3 Coat protein 772429 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P03623:p.Val28Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false oxaa_ecoli YidC 772430 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false TM1 P25714:p.Ser16Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false disulfide bond disulfide bond disulfide bridge SS-bond false false false F3 mint viii-yidc-3 772428 capsd_bppf3 Coat protein 772429 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P03623:p.Val28Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false oxaa_ecoli YidC 772430 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false TM3 P25714:p.Met430Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false disulfide bond disulfide bond disulfide bridge SS-bond false false false F3 mint viii-yidc-4 772428 capsd_bppf3 Coat protein 772429 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P03623:p.Ile27Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false oxaa_ecoli YidC 772430 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false TM1 P25714:p.Phe17Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false disulfide bond disulfide bond disulfide bridge SS-bond false false false F5 mint