DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ pang-2009-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Pang T., Savva CG., Fleming KG., Struck DK., Young R. DIP original experiment: DIP-134714X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structure of the lethal phage pinhole. Pang T., Savva CG., Fleming KG., Struck DK., Young R. Only protein-protein interactions imex curation pang-2009-5 ecolx Escherichia coli electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Pang T., Savva CG., Fleming KG., Struck DK., Young R. DIP original experiment: DIP-134715X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structure of the lethal phage pinhole. Pang T., Savva CG., Fleming KG., Struck DK., Young R. Only protein-protein interactions imex curation pang-2009-6 ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Pang T., Savva CG., Fleming KG., Struck DK., Young R. DIP original experiment: DIP-134716X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structure of the lethal phage pinhole. Pang T., Savva CG., Fleming KG., Struck DK., Young R. Only protein-protein interactions imex curation park-2006-16 ecolx Escherichia coli crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Park T., Struck DK., Deaton JF., Young R. DIP original experiment: DIP-264289X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Topological dynamics of holins in programmed bacterial lysis. Park T., Struck DK., Deaton JF., Young R. Only protein-protein interactions imex curation holin_bpp21 Antiholin S protein protein bpp21 Enterobacteria phage P21 Bacteriophage 21 Bacteriophage P21 MKSMDKISTGIAYGTSAGSAGYWFLQWLDQVSPSQWAAIGVLGSLVLGFLTYLTNLYFKIREDRRKAARGE s-6 3198152 N/A 3198155 unspecified role unspecified role unspecified role unspecified role Holin protein Region 4-71 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false s-7 3198153 N/A 3198155 unspecified role unspecified role unspecified role unspecified role Holin protein Region 4-71 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false s-8 3198154 N/A 3198155 unspecified role unspecified role unspecified role unspecified role Holin protein Region 4-71 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false s-5 3151452 N/A 3198155 unspecified role unspecified role unspecified role unspecified role Region 4-71 Region 4-71 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P27360:p.Ser16Cys S16C mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false