DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ gertsman-2009-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Gertsman I., Gan L., Guttman M., Lee K., Speir JA., Duda RL., Hendrix RW., Komives EA., Johnson JE. DIP original experiment: DIP-249859X Nature 2009 IMEx An unexpected twist in viral capsid maturation. Gertsman I., Gan L., Guttman M., Lee K., Speir JA., Duda RL., Hendrix RW., Komives EA., Johnson JE. Only protein-protein interactions imex curation lee-2008-18 ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Lee KK., Gan L., Tsuruta H., Moyer C., Conway JF., Duda RL., Hendrix RW., Steven AC., Johnson JE. DIP original experiment: DIP-113224X Structure (London, England : 1993) 2008 IMEx Virus capsid expansion driven by the capture of mobile surface loops. Lee KK., Gan L., Tsuruta H., Moyer C., Conway JF., Duda RL., Hendrix RW., Steven AC., Johnson JE. Only protein-protein interactions imex curation lee-2008-19 ecolx Escherichia coli crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Lee KK., Gan L., Tsuruta H., Moyer C., Conway JF., Duda RL., Hendrix RW., Steven AC., Johnson JE. DIP original experiment: DIP-113225X Structure (London, England : 1993) 2008 IMEx Virus capsid expansion driven by the capture of mobile surface loops. Lee KK., Gan L., Tsuruta H., Moyer C., Conway JF., Duda RL., Hendrix RW., Steven AC., Johnson JE. Only protein-protein interactions imex curation veesler-2014-1 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. DIP original experiment: DIP-259659X Structure (London, England : 1993) 2014 IMEx Architecture of a dsDNA viral capsid in complex with its maturation protease. Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. Only protein-protein interactions imex curation veesler-2014-2 ecolx Escherichia coli h1-h2 ms mass spectrometry study of hydrogen/deuterium exchange h1-h2 ms predetermined predetermined participant predetermined Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. DIP original experiment: DIP-259663X Structure (London, England : 1993) 2014 IMEx Architecture of a dsDNA viral capsid in complex with its maturation protease. Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. Only protein-protein interactions imex curation veesler-2014-3 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. DIP original experiment: DIP-259660X Structure (London, England : 1993) 2014 IMEx Architecture of a dsDNA viral capsid in complex with its maturation protease. Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. Only protein-protein interactions imex curation veesler-2014-4 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. DIP original experiment: DIP-259661X Structure (London, England : 1993) 2014 IMEx Architecture of a dsDNA viral capsid in complex with its maturation protease. Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. Only protein-protein interactions imex curation veesler-2014-5 ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. DIP original experiment: DIP-259662X Structure (London, England : 1993) 2014 IMEx Architecture of a dsDNA viral capsid in complex with its maturation protease. Veesler D., Khayat R., Krishnamurthy S., Snijder J., Huang RK., Heck AJ., Anand GS., Johnson JE. Only protein-protein interactions imex curation gan-2006-1 ecolx Escherichia coli affinity techniques affinity technology affinity techniques predetermined predetermined participant predetermined Gan L., Speir JA., Conway JF., Lander G., Cheng N., Firek BA., Hendrix RW., Duda RL., Liljas L., Johnson JE. DIP original experiment: DIP-66384X Structure (London, England : 1993) 2006 IMEx Capsid conformational sampling in HK97 maturation visualized by X-ray crystallography and cryo-EM. Gan L., Speir JA., Conway JF., Lander G., Cheng N., Firek BA., Hendrix RW., Duda RL., Liljas L., Johnson JE. Only protein-protein interactions imex curation gan-2006-2 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Gan L., Speir JA., Conway JF., Lander G., Cheng N., Firek BA., Hendrix RW., Duda RL., Liljas L., Johnson JE. DIP original experiment: DIP-66385X Structure (London, England : 1993) 2006 IMEx Capsid conformational sampling in HK97 maturation visualized by X-ray crystallography and cryo-EM. Gan L., Speir JA., Conway JF., Lander G., Cheng N., Firek BA., Hendrix RW., Duda RL., Liljas L., Johnson JE. Only protein-protein interactions imex curation gan-2006-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Gan L., Speir JA., Conway JF., Lander G., Cheng N., Firek BA., Hendrix RW., Duda RL., Liljas L., Johnson JE. DIP original experiment: DIP-66386X Structure (London, England : 1993) 2006 IMEx Capsid conformational sampling in HK97 maturation visualized by X-ray crystallography and cryo-EM. Gan L., Speir JA., Conway JF., Lander G., Cheng N., Firek BA., Hendrix RW., Duda RL., Liljas L., Johnson JE. Only protein-protein interactions imex curation veesler-2012-1 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Veesler D., Quispe J., Grigorieff N., Potter CS., Carragher B., Johnson JE. DIP original experiment: DIP-250486X Structure (London, England : 1993) 2012 IMEx Maturation in action: CryoEM study of a viral capsid caught during expansion. Veesler D., Quispe J., Grigorieff N., Potter CS., Carragher B., Johnson JE. Only protein-protein interactions imex curation pro_bphk7 Prohead protease 4 GP4 protein protein bphk7 Enterobacteria phage HK97 Bacteriophage HK97 MPEIVKTLSFDETEIKFTGDGKQGIFEGYASVFNNTDSDGDIILPGAFKNALANQTRKVAMFFNHKTWELPVGKWDSLAEDEKGLYVRGQLTPGHSGAADLKAAMQHGTVEGMSVGFSVAKDDYTIIPTGRIFKNIQALREISVCTFPANEQAGIAAMKSVDGIETIRDVENWLRDSVGLTKSQAVGLIARFKSAIRSESEGDGNEAQINALLQSIKSFPSNLGK capsd_bphk7 Major capsid protein Gene product 5 Major head protein 5 protein protein bphk7 Enterobacteria phage HK97 Bacteriophage HK97 MSELALIQKAIEESQQKMTQLFDAQKAEIESTGQVSKQLQSDLMKVQEELTKSGTRLFDLEQKLASGAENPGEKKSFSERAAEELIKSWDGKQGTFGAKTFNKSLGSDADSAGSLIQPMQIPGIIMPGLRRLTIRDLLAQGRTSSNALEYVREEVFTNNADVVAEKALKPESDITFSKQTANVKTIAHWVQASRQVMDDAPMLQSYINNRLMYGLALKEEGQLLNGDGTGDNLEGLNKVATAYDTSLNATGDTRADIIAHAIYQVTESEFSASGIVLNPRDWHNIALLKDNEGRYIFGGPQAFTSNIMWGLPVVPTKAQAAGTFTVGGFDMASQVWDRMDATVEVSREDRDNFVKNMLTILCEERLALAHYRPTAIIKGTFSSGS 5-7 3184035 N/A 3184036 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false 5-5 3178804 N/A 3184036 unspecified role unspecified role unspecified role unspecified role Region 104-385 Region 104-385 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false 5-6 3178805 N/A 3184036 unspecified role unspecified role unspecified role unspecified role Region 104-385 Region 104-385 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false 5-9 3261595 N/A 3184036 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false 4-5 3261596 N/A 3261601 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3184036 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false 5-10 3261597 N/A 3184036 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false 4-2 3261598 N/A 3261601 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3184036 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false 4-3 3261599 N/A 3261601 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3184036 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false 5-2 3150318 N/A 3184036 unspecified role unspecified role unspecified role unspecified role Region 104-385 Region 104-385 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false 5-3 3150319 N/A 3184036 unspecified role unspecified role unspecified role unspecified role Region 104-385 Region 104-385 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false 5-4 3150320 N/A 3184036 unspecified role unspecified role unspecified role unspecified role Region 104-385 Region 104-385 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false 5-11 3241970 N/A 3184036 unspecified role unspecified role unspecified role unspecified role Region 1-158/172-385 Region 1-158/172-385 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false