DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ miller-2008-1 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Miller JL., Le Coq J., Hodes A., Barbalat R., Miller JF., Ghosh P. DIP original experiment: DIP-110842X PLoS biology 2008 IMEx Selective ligand recognition by a diversity-generating retroelement variable protein. Miller JL., Le Coq J., Hodes A., Barbalat R., Miller JF., Ghosh P. Only protein-protein interactions imex curation miller-2008-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Miller JL., Le Coq J., Hodes A., Barbalat R., Miller JF., Ghosh P. DIP original experiment: DIP-110846X PLoS biology 2008 IMEx Selective ligand recognition by a diversity-generating retroelement variable protein. Miller JL., Le Coq J., Hodes A., Barbalat R., Miller JF., Ghosh P. Only protein-protein interactions imex curation miller-2008-3 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Miller JL., Le Coq J., Hodes A., Barbalat R., Miller JF., Ghosh P. DIP original experiment: DIP-110847X PLoS biology 2008 IMEx Selective ligand recognition by a diversity-generating retroelement variable protein. Miller JL., Le Coq J., Hodes A., Barbalat R., Miller JF., Ghosh P. Only protein-protein interactions imex curation miller-2008-4 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Miller JL., Le Coq J., Hodes A., Barbalat R., Miller JF., Ghosh P. DIP original experiment: DIP-110849X PLoS biology 2008 IMEx Selective ligand recognition by a diversity-generating retroelement variable protein. Miller JL., Le Coq J., Hodes A., Barbalat R., Miller JF., Ghosh P. Only protein-protein interactions imex curation miller-2008-5 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Miller JL., Le Coq J., Hodes A., Barbalat R., Miller JF., Ghosh P. DIP original experiment: DIP-110843X PLoS biology 2008 IMEx Selective ligand recognition by a diversity-generating retroelement variable protein. Miller JL., Le Coq J., Hodes A., Barbalat R., Miller JF., Ghosh P. Only protein-protein interactions imex curation miller-2008-6 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Miller JL., Le Coq J., Hodes A., Barbalat R., Miller JF., Ghosh P. DIP original experiment: DIP-110845X PLoS biology 2008 IMEx Selective ligand recognition by a diversity-generating retroelement variable protein. Miller JL., Le Coq J., Hodes A., Barbalat R., Miller JF., Ghosh P. Only protein-protein interactions imex curation miller-2008-7 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Miller JL., Le Coq J., Hodes A., Barbalat R., Miller JF., Ghosh P. DIP original experiment: DIP-110848X PLoS biology 2008 IMEx Selective ligand recognition by a diversity-generating retroelement variable protein. Miller JL., Le Coq J., Hodes A., Barbalat R., Miller JF., Ghosh P. Only protein-protein interactions imex curation miller-2008-8 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Miller JL., Le Coq J., Hodes A., Barbalat R., Miller JF., Ghosh P. DIP original experiment: DIP-110844X PLoS biology 2008 IMEx Selective ligand recognition by a diversity-generating retroelement variable protein. Miller JL., Le Coq J., Hodes A., Barbalat R., Miller JF., Ghosh P. Only protein-protein interactions imex curation mcmahon-2005-2 in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie McMahon SA., Miller JL., Lawton JA., Kerkow DE., Hodes A., Marti-Renom MA., Doulatov S., Narayanan E., Sali A., Miller JF., Ghosh P. DIP original experiment: DIP-254798X Nature structural & molecular biology 2005 IMEx The C-type lectin fold as an evolutionary solution for massive sequence variation. McMahon SA., Miller JL., Lawton JA., Kerkow DE., Hodes A., Marti-Renom MA., Doulatov S., Narayanan E., Sali A., Miller JF., Ghosh P. Only protein-protein interactions imex curation mcmahon-2005-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined McMahon SA., Miller JL., Lawton JA., Kerkow DE., Hodes A., Marti-Renom MA., Doulatov S., Narayanan E., Sali A., Miller JF., Ghosh P. DIP original experiment: DIP-254800X Nature structural & molecular biology 2005 IMEx The C-type lectin fold as an evolutionary solution for massive sequence variation. McMahon SA., Miller JL., Lawton JA., Kerkow DE., Hodes A., Marti-Renom MA., Doulatov S., Narayanan E., Sali A., Miller JF., Ghosh P. Only protein-protein interactions imex curation mcmahon-2005-4 in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined McMahon SA., Miller JL., Lawton JA., Kerkow DE., Hodes A., Marti-Renom MA., Doulatov S., Narayanan E., Sali A., Miller JF., Ghosh P. DIP original experiment: DIP-254801X Nature structural & molecular biology 2005 IMEx The C-type lectin fold as an evolutionary solution for massive sequence variation. McMahon SA., Miller JL., Lawton JA., Kerkow DE., Hodes A., Marti-Renom MA., Doulatov S., Narayanan E., Sali A., Miller JF., Ghosh P. Only protein-protein interactions imex curation mcmahon-2005-5 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined McMahon SA., Miller JL., Lawton JA., Kerkow DE., Hodes A., Marti-Renom MA., Doulatov S., Narayanan E., Sali A., Miller JF., Ghosh P. DIP original experiment: DIP-254799X Nature structural & molecular biology 2005 IMEx The C-type lectin fold as an evolutionary solution for massive sequence variation. McMahon SA., Miller JL., Lawton JA., Kerkow DE., Hodes A., Marti-Renom MA., Doulatov S., Narayanan E., Sali A., Miller JF., Ghosh P. Only protein-protein interactions imex curation pert_borbr Pertactin autotransporter P.94 BB1366 prn protein protein borbr Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) Alcaligenes bronchisepticus MNMSLSRIVKAAPLRRTTLAMALGALGALGAAPAAHADWNNQSIIKAGERQHGIHIKQSDGAGVRTATGTTIKVSGRQAQGVLLENPAAELRFQNGSVTSSGQLFDEGVRRFLGTVTVKAGKLVADHATLANVSDTRDDDGIALYVAGEQAQASIADSTLQGAGGVRVERGANVTVQRSTIVDGGLHIGTLQPLQPEDLPPSRVVLGDTSVTAVPASGAPAAVSVFGANELTVDGGHITGGRAAGVAAMDGAIVHLQRATIRRGDAPAGGAVPGGAVPGGAVPGGFGPLLDGWYGVDVSDSTVDLAQSIVEAPQLGAAIRAGRGARVTVSGGSLSAPHGNVIETGGGARRFPPPASPLSITLQAGARAQGRALLYRVLPEPVKLTLAGGAQGQGDIVATELPPIPGASSGPLDVALASQARWTGATRAVDSLSIDNATWVMTDNSNVGALRLASDGSVDFQQPAEAGRFKVLMVDTLAGSGLFRMNVFADLGLSDKLVVMRDASGQHRLWVRNSGSEPASANTMLLVQTPRGSAATFTLANKDGKVDIGTYRYRLAANGNGQWSLVGAKAPPAPKPAPQPGPQPGPQPPQPPQPPQRQPEAPAPQPPAGRELSAAANAAVNTGGVGLASTLWYAESNALSKRLGELRLNPDAGGAWGRGFAQRQQLDNRAGRRFDQKVAGFELGADHAVAVAGGRWHLGGLAGYTRGDRGFTGDGGGHTDSVHVGGYATYIANSGFYLDATLRASRLENDFKVAGSDGYAVKGKYRTHGVGASLEAGRRFAHADGWFLEPQAELAVFRVGGGAYRAANGLRVRDEGGSSVLGRLGLEVGKRIELAGGRQVQPYIKASVLQEFDGAGTVRTNGIAHRTELRGTRAELGLGMAAALGRGHSLYASYEYSKGPKLAMPWTFHAGYRYSW fibd_bpbpp Tail fiber receptor-binding protein Major tropism determinant protein mtd protein protein bpbpp Bordetella phage BPP-1 MSTAVQFRGGTTAQHATFTGAAREITVDTDKNTVVVHDGATAGGFPLARHDLVKTAFIKADKSAVAFTRTGNATASIKAGTIVEVNGKLVQFTADTAITMPALTAGTDYAIYVCDDGTVRADSNFSAPTGYTSTTARKVGGFHYAPGSNAAAQAGGNTTAQINEYSLWDIKFRPAALDPRGMTLVAGAFWADIYLLGVNHLTDGTSKYNVTIADGSASPKKSTKFGGDGSAAYSDGAWYNFAEVMTHHGKRLPNYNEFQALAFGTTEATSSGGTDVPTTGVNGTGATSAWNIFTSKWGVVQASGCLWTWGNEFGGVNGASEYTANTGGRGSVYAQPAAALFGGAWNGTSLSGSRAALWYSGPSFSFAFFGARGVCDHLILE mtdm1 hypothetical protein predicted by GeneMark protein protein bordetella phage bmp-1 Bordetella phage BMP-1 mtdp6 Phage tail protein protein protein bpp1virus Bpp1virus MSTAVQFRGGTTAQHATFTGAAREITVDTDKNTVVVHDGATAGGFPLARHDLVKTAFIKADKSAVAFTRTGNATASIKAGTIVEVNGKLVQFTADTAITMPALTAGTDYAIYVCDDGTVRADSNFSAPTGYTSTTARKVGGFHYAPGSNAAAQAGGNTTAQINEYSLWDIKFRPAALDPRGMTLVAGAFWADIYLLGVNHLTDGTSKYNVTIADGSASPKKSTKFGGDGSAAYSDGAWYNFAEVMTHHGKRLPNYNEFQALAFGTTEATSSGGTDVPTTGVNGTGATSAWNIFTSKWGVVQASGCLWTWGNEFGGVNGASEYTANTGGRGSVYAQPAAALFGGSWHYTSNSGSRAAIWYYGPSISNASIGARGVCDHLILE mtd-prn_e-1 3172574 N/A 3172582 unspecified role unspecified role unspecified role unspecified role Region 38-640 Region 38-640 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3172583 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false prn_e-mtd-1 3172575 N/A 3172582 unspecified role unspecified role bait bait Region 38-640 Region 38-640 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3172583 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false prn_e-mtdm1-1 3172576 N/A 3172584 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3172582 unspecified role unspecified role bait bait Region 38-640 Region 38-640 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false prn_e-mtdp6-1 3172577 N/A 3172585 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3172582 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 38-640 Region 38-640 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false mtd-prn_e-2 3172578 N/A 3172582 unspecified role unspecified role unspecified role unspecified role Region 38-640 Region 38-640 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3172583 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false prn_e-mtdm1-2 3172579 N/A 3172584 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3172582 unspecified role unspecified role bait bait Region 190-199 Region 190-199 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false prn_e-mtdp6-2 3172580 N/A 3172585 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3172582 unspecified role unspecified role bait bait Region 38-640 Region 38-640 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false prn_e-mtd-2 3172581 N/A 3172582 unspecified role unspecified role bait bait Region 399-407 Region 399-407 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 190-199 Region 190-199 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3172583 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false prn-mtd-1 3138865 N/A 3172582 unspecified role unspecified role bait bait Region 38-640 Region 38-640 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3172583 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false mtd-prn-1 3138866 N/A 3172582 unspecified role unspecified role unspecified role unspecified role Region 38-640 Region 38-640 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3172583 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mtd-prn-2 3138867 N/A 3172582 unspecified role unspecified role unspecified role unspecified role Region 38-640 Region 38-640 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3172583 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false mtd-prn-3 3138868 N/A 3172582 unspecified role unspecified role unspecified role unspecified role Region 38-640 Region 38-640 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3172583 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint li-2013h-1 SET-domain bacterial effectors target heterochromatin protein 1 to activate host rDNA transcription. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Li T., Lu Q., Wang G., Xu H., Huang H., Cai T., Kan B., Ge J., Shao F. liting@caiq.gov.cn EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation a0a0h3lym0_borbr BB4970 protein protein borbr Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) Alcaligenes bronchisepticus MTEIIKPWHSVRRSRLHGNGVFATRKIPAGTRIIEYGGKRISAAEADRRHPTNPDDPFHTFFFSLSSGRVIDGGDEGNDARWINHSCDPNCEAQEGRHGKRVYIVALRDIARGEELFYDYGLVLDGRITRKLKEGYRCLCGTTPCRGTMLALPEKKKTKARSAEKA q2stb6_burta BTH_I3341 protein protein burta Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) MRRSARRRSTGVRSRASTRRCSATYRSASVERRARRMEAGRRRAARMPISSAPIRLPMRPIFRQLRGFRATSRIARPFDVERSNPERVGFGDSNPSRRAACQPYTARRAKPRGRHAMRGAIVSVSSRHQRIRSMSSRRIVVRRSGVHGKGVFAAVPIKAGERVVEYKGERISWKEALRRHPHDPNDPNHTFYFALEEGGVIDGKIDGNSARWINHSCAPNCEAEEVDGRVYIHALRDIGEQEELFYDYGLVIDARLTKKLKREYACHCGAATCRGTLLATSEDDEGKKKKKAKKGGKDKKKKK npm_human Nucleophosmin NPM1 NPM Nucleolar phosphoprotein B23 Numatrin Nucleolar protein NO38 protein protein human Homo sapiens Human MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL q5zus4_legph legAS4 lpg1718 protein protein legph Legionella pneumophila subsp. pneumophila MIILYDFLQESSVMPRSKNDSKLKKKSALQSKFKEQQLNHGSKEHKSKFKFSQRKAKKKGPGMTHLPGNIYTLFTPVNGPKSKDEWIDTSKIMLDLHIDNMSSSDYIPSAIDRTDLVMVQSVHLLRKTGGRGLFAREDIPKGTCIGIYTGEVYSEQEFEQYLKEHVGSDKSYAMYVGGRVIDAARKGNLTRYINFSDSQDNAEFVETTLNRKKVAKVITTKNIKAGQQLLINYNTYEEQASRYYYFLNPGDGWLSAQEFYQTYQSQYRLEQMPYNLEGFDLKAGDRVLMTQIGRIILANYSLAKEQELNASDIDLPFLKVGSDEKILDFDEADTFTPLMAACYLGQVENVKWLIEHGANIDQQQSHSGHCPLSLTLKGYSLAKDTQKYIDIIQLLIKNQVNLLVHDRSDKTFLHNAALVLNNLDFQSVVKFLIGQNPIDINEYFTYIDENDFDIVMHCYNNKLFDKALVLLAFYPDYFKRNYMSDNEGHNQFNINAFRKAIKDFNSNERSILLMQLRESGLHLPEDLLEQLGIMDSSITLESKFF legas4-npm1 1459213 n/a 1459217 tag visualisation tag visualisation unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 1459219 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f1b sf1c npm1-q7wdl8 1459213 n/a 1459220 tag visualisation tag visualisation unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459219 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f3b npm1-q7wdl8-1 1459213 n/a 1459221 tag visualisation tag visualisation unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1459219 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f3b