MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint rodikova-2007-1 Two HlyIIR dimers bind to a long perfect inverted repeat in the operator of the hemolysin II gene from Bacillus cereus. in vitro In vitro cosedimentation cosedimentation predetermined predetermined participant predetermined Rodikova EA., Kovalevskiy OV., Mayorov SG., Budarina ZI., Marchenkov VV., Melnik BS., Leech AP., Nikitin DV., Shlyapnikov MG., Solonin AS. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation rodikova-2007-2 Two HlyIIR dimers bind to a long perfect inverted repeat in the operator of the hemolysin II gene from Bacillus cereus. in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Rodikova EA., Kovalevskiy OV., Mayorov SG., Budarina ZI., Marchenkov VV., Melnik BS., Leech AP., Nikitin DV., Shlyapnikov MG., Solonin AS. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation rodikova-2007-3 Two HlyIIR dimers bind to a long perfect inverted repeat in the operator of the hemolysin II gene from Bacillus cereus. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Rodikova EA., Kovalevskiy OV., Mayorov SG., Budarina ZI., Marchenkov VV., Melnik BS., Leech AP., Nikitin DV., Shlyapnikov MG., Solonin AS. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation mutahir-2013-1 Thymidine kinase 1 regulatory fine-tuning through tetramer formation. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column experimental particp experimental participant identification experimental particp Mutahir Z., Clausen AR., Andersson KM., Wisen SM., Munch-Petersen B., Piškur J. Zeeshan.Mutahir@biol.lu.se FEBS J. (1742-464X) 2013 q7x506_bacce FOC75_10310 hlyIIR CQZ91_02635 protein protein bacce Bacillus cereus MGKSREQTMENILKAAKKKFGERGYEGTSIQEIAKEAKVNVAMASYYFNGKENLYYEVFKKYGLANELPNFLEKNQFNPINALREYLTVFTTHIKENPEIGTLAYEEIIKESARLEKIKPYFIGSFEQLKEILQEGEKQGVFHFFSINHTIHWITSIVLFPKFKKFIDSLGTNETNDTNHEWMPEDLVSRIISALTDKPNI mint kitha_arath Thymidine kinase a TK1A F17A17.14 MLP3.25 At3g07800 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATLKASFLIKTLDSDVTGDFLSDLERRGSGAVHVIMGPMFSGKSTSLLRRIKSEISDGRSVAMLKSSKDTRYAKDSVVTHDGIGFPCWALPDLMSFPEKFGLDAYNKLDVIGIDEAQFFGDLYEFCCKVADDDGKIVIVAGLDGDYLRRSFGAVLDIIPIADSVTKLTARCEVCGHKAFFTLRKNCDTRTELIGGADVYMPVCRKHYITNHIVIKASKKVLEDSDKARAESCVAATI kithb_arath Thymidine kinase b TK1B MYJ24.6 At5g23070 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MFGVSMRTLISPSLAPFSLHLHKPSLFSTALRFSFSINNITPTNSPPSTISTRKLQTKATRVTSSSSSQPLSSSSPGEIHVVVGPMFSGKTTTLLRRILAERETGKRIAIIKSNKDTRYCTESIVTHDGEKYPCWSLPDLSSFKERFGFDDYENRLDVIGIDEAQFFGDLYEFCREAADKEGKTVIVAGLDGDFMRRRFGSVLDLIPIADTVTKLTSRCEVCGKRALFTMRKTEEKETELIGGAEVYMPVCRSHYVCGQNVLETARAVLDSSNNHSVVASSL mint kith_dicdi Thymidine kinase 1 thyB Calmodulin-binding protein ThyB DDB_G0289179 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MIVTQIAGKIQVIFGPMFSGKTTELIRRIKRFNFANKKCLLIKYSKDTRYNDNIDKSFLVTHDKQNYQAFPCSILEDVKEQAQNYDVIGIDEGQFFPDVVQFSEDLANQGKTVIIAALDGTFQRKPFQSVIDLVSKAEYITKLTAVCMVCYNEAAFSKRIVESDDIELIGGIDKYISVCRGCYNSDQNEGNSTKPSKTARHSHSQSAPSVAPLAVNINPDDHLNNDY mint g5eez5_caeel Thymidine kinase thk-1 4L44 CELE_Y43C5A.5 Y43C5A.5 protein protein caeel Caenorhabditis elegans MDIEAAKNEMTCCSSNSSLSDFNTLPRCPNRVGSITVILGPMFSGKTTELLRLHDRQIIAKRTCVLVKYAGDTRYDADLVATHSKMTGQGRTVKAHRLSEVQSQIFNDEVQVVSIDEGQFFEDLAETCEELAQRGKVVCVAALNGTFERKPFPQISLLLPYANEIKQVTAVCVECGSQANFSFRSTLDKKVEVIGGSDTYTALCRECYVQKSEEKDAEEQMKTGCDKNENDITGIFLAKKEQRSDGSVSPPRKKIGLSKSMALEATART mint q0h0h6_bacce Thymidine kinase CJ306_28485 NCTC7464_02567 F8172_17950 BKK64_12090 COK98_18730 CON37_06430 DR116_0009955 tdk2 A9485_15835 AT268_20020 BLX06_03770 CN357_30570 CN980_06535 COC69_01765 COD77_24400 COI98_09330 CON36_03255 tdk TU58_06975 WR52_27175 FC695_06390 FC702_23420 C6Y54_21655 D0437_26050 FC692_22460 C1N66_11430 C6A78_14085 protein protein bacce Bacillus cereus MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNGLKVKAVPVSASKDIFEHITEELDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDFRGLPFGQVPQLMAIAEHVTKLQAVCSVCGSPASRTQRLIDGEPAAFDDPIILVGASESYEPRCRHCHAVPANKDK mint kith_rat Thymidine kinase, cytosolic Tk1 Tk-1 protein protein rat Rattus norvegicus (Rat) Rat MSYINLPTVLPISPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSNSFSTHDRNTMDALPACMLKDVAQEALGVAVIGIDEGQFFPDIVDFCETMANTGKTVIV mint q803y1_danre Thymidine kinase tk1 TK1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MDCLNVARILPNSPRKTRGQIQVIFGPMFSGKSTELMRRVRRFQVAQYSCLLIKYAKDTRYSCTGMATHDMNTMEAVPANRLRDVAPLALQACVIGIDEGQFFPDTVEFCEEMANMGKTIIVAALDGTFQRKAFGNILNLVPLAESVVKLNAVCMQCFKEAAYTKRLGAEKEVEVIGGSDKYHAVCRCCYGGLMKENRSPQREETPPHASAAKTLEYSTATRKLFTALHL mint q5i0a2_xentr Thymidine kinase TEgg105a12.1-001 tk1 protein protein xentr Xenopus tropicalis (Western clawed frog) Silurana tropicalis MNCLNVPEIMPGSPSKSRGQIQVIFGPMFSGKSTELMRRVRRFQIAQYKCMLIKYAKDTRYSKEHLATHDQNTMAAVSACQLRDVSAEALACSVIGIDEGQFFPDIVDFCEEMANRGKTMIVAALDGTFQRKAFGNILNLVPLAESVVKLNSVCMECYREAAYTKRLGAEKEVEVIGGAEKYHSVCRLCFFKNQQLPVEKENVLSHNALDTISLKLSNKLQTACSPRKPLAQRQCL mint c3val3_anoca Thymidine kinase TK1 protein protein anoca Anolis carolinensis MNCLMMPGVQPGSPRKARGQIQVIFGPMFSGKSTELMRRVRRFQIAQYKCLLIKYAKDTRYCVNGVSTHDRNTMEAVSACCLKDVHQEALSSAVIGIDEGQFFPDIIEFCEAMANAGKTVIVAALGGTFQRKAFGNILHLVPLAESVVKLNAVCMECFREASYTKRLGAEKEVEVIGGADKYHSVCRVCYFKKRPQQPTENKENLPSGHKQLEPTASRKVLGICQNMQWGPSN mint kith_chick Thymidine kinase, cytosolic TK1 protein protein chick Gallus gallus (Chicken) Chicken MNCLTVPGVHPGSPGRPRGQIQVIFGPMFSGKSTELMRRVRRFQLAQYRCLLVKYAKDTRYCTTGVSTHDRNTMEARPACALQDVYQEALGSAVIGIDEGQFFPDIVEFCEKMANTGKTVIVAALDGTFQRKAFGSILNLVPLAESVVKLNAVCMECYREASYTKRLGAEREVEVIGGADKYHSVCRACYFQKRPQQLGSENKENVPMGVKQLDMPASRKIFAS mint hlyiir 607530 q7x506_bacce HlyIIR 607533 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false F3 mint hlyiir-1 607531 q7x506_bacce HlyIIR 607533 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false F4 mint hlyiir-1 607532 q7x506_bacce HlyIIR 607533 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false F2 mint tdk-1 1362138 bctk1 BcTK1 1362139 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false T2 F2 mint f17a17.14 1362138 attk1a AtTK1a 1362140 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false T2 F2 mint q9fn47 1362138 attk1b-dn45 AtTK1b-dN45 1362141 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false T2 F2 mint thyb 1362138 ddtk1 DdTK1 1362142 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false T2 F2 mint thk 1362138 cetk1 CeTK1 1362143 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction false false false T2 F2 mint tk1-1 1362138 drtk1 DrTK1 1362144 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction false false false T2 F2 mint tk1-1 1362138 q5i0a2_xentr XtTK1 1362145 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction false false false T2 F2 mint tk1-1 1362138 actk1 AcTK1 1362146 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false T2 F2 mint tk1-1 1362138 kith_chick GgTK1 1362147 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false T2 F2 mint tk1-1 1362138 rntk1 RnTK1 1362148 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false T2 F2 mint tk1-1 1362138 q5i0a2_xentr XtTK1 1362145 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false T2 F2 mint tk1-1 1362138 actk1 AcTK1 1362146 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction false false false T2 F2 mint tk1-1 1362138 kith_chick GgTK1 1362147 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction false false false T2 F2 mint tk1-1 1362138 rntk1 RnTK1 1362148 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction false false false T2 F2 mint