IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ueki-2007-2 Identification of Vanabin-interacting protein 1 (VIP1) from blood cells of the vanadium-rich ascidian Ascidia sydneiensis samea. ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ueki T., Shintaku K., Yonekawa Y., Takatsu N., Yamada H., Hamada T., Hirota H., Michibata H. Vanabin2 recombinant protein was synthesized as a fusion protein with MBP, excised using Factor Xa, purified, and biotinylated for use as a probe. Bound proteins were detected by ECL, cDNAs were excised and sequence(s) determined. hmichi@hiroshima-u.ac.jp Blood cell cDNA library of A. sydneiensis samea. Biochim. Biophys. Acta (0006-3002) 2007 Only protein-protein interactions imex curation ueki-2007-1 Identification of Vanabin-interacting protein 1 (VIP1) from blood cells of the vanadium-rich ascidian Ascidia sydneiensis samea. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting tag visualisation tag visualisation Ueki T., Shintaku K., Yonekawa Y., Takatsu N., Yamada H., Hamada T., Hirota H., Michibata H. Vanabin2 recombinant protein was synthesized as a fusion protein with MBP, excised using Factor Xa, purified, and biotinylated for use as a probe. Bound proteins were detected by ECL, cDNAs were excised and sequence(s) determined. hmichi@hiroshima-u.ac.jp Blood cell cDNA library of A. sydneiensis samea. Biochim. Biophys. Acta (0006-3002) 2007 Only protein-protein interactions imex curation vbp2_ascss Vanadium-binding protein 2 VANABIN2 protein protein ascss Ascidia sydneiensis samea (Vanadium-rich ascidian) MSKVIFALVLVVVLVACINATYVEFEEAYAPVDCKGQCTTPCEPLTACKEKCAESCETSADKKTCRRNCKKADCEPQDKVCDACRMKCHKACRAANCASECPKHEHKSDTCRACMKTNCK a4f2k9_ascss VIP1 protein protein ascss Ascidia sydneiensis samea (Vanadium-rich ascidian) MMKTGIVILSIYFLVQRIVGKCVKNRYNDFNGDLYISKNGEEMCSWDFVQPNTMLDYVLVLRVFPLCDTSSLLSSASVTMPDGQDIENEIDQGEDVFCGSYVKSNKSCAANPNIRKLCNKTASTSVDWPPRFSAKLHRYSMVATYFYYKCGEAFNNISTKEGERSDNTTPLNGNDQTPLRYPTTNGEGNNNGATQTLGLSAYTSTTSSTRVKPEPLTKTKWIAIVIAILFLFSCILNVYLFAKCRQIRRLSSLKSIPPSEPTQEVVXHENIYTQQETEAQESNTEQLYQTTRNEVLDSNAVYNHLERQ q86bw3_ascss vanabin1 protein protein ascss Ascidia sydneiensis samea (Vanadium-rich ascidian) MVSKFTILLGVVVLMALSVNAYESEFDDETFEKGPGCKCQSVCGEVKKCGVKCFRSCNGDRDCTKDCAKAKCGKVPNAGDCGHCMLSCEGKCRADHCASACPGKVSKAPGCLDCMKLNCV a7vmv5_ascss Vanabin3 protein protein ascss Ascidia sydneiensis samea (Vanadium-rich ascidian) MASKLFLLLFLGMFVLIAASDESFDEEEDFEDEVMAQSYYPECDCRQECGTFRNCRATCRANCGDGRCRRECKRTKCINMKSQCRNCNGDCRERCRSKYCSKPCYKSLKVRKCVRCMVVSCHLRF a7vmv6_ascss Vanabin4 protein protein ascss Ascidia sydneiensis samea (Vanadium-rich ascidian) MVTKSHIIFFLGMVVVIVGCPAFEKFVSKNEESVIVDSCKTNCSTECLPLKNCTENCTEHCEGLSDKKACHQNCRKVTCKAEDGQCRACKKKCKDECKKANCKSSCEEKAMKSPACKSCMEKNCH van2-vip1-2 970289 n/a 970291 unspecified role unspecified role bait bait n/a 970292 unspecified role unspecified role prey prey n terminal sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 1. VIP1 interacted with Vanabins 1-4 but not with VanabinP. van2-van1 970289 n/a 970293 unspecified role unspecified role prey prey n/a 970291 unspecified role unspecified role bait bait physical association physical association false false false Table 1. VIP1 interacted with Vanabins 1-4 but not with VanabinP. vip1-van2 970289 n/a 970292 unspecified role unspecified role bait bait n/a 970291 unspecified role unspecified role prey prey physical association physical association false false false Table 1. VIP1 interacted with Vanabins 1-4 but not with VanabinP. vip1-van1 970289 n/a 970293 unspecified role unspecified role prey prey n/a 970292 unspecified role unspecified role bait bait physical association physical association false false false Table 1. VIP1 interacted with Vanabins 1-4 but not with VanabinP. vip1-van3 970289 n/a 970294 unspecified role unspecified role prey prey n/a 970292 unspecified role unspecified role bait bait physical association physical association false false false Table 1. VIP1 interacted with Vanabins 1-4 but not with VanabinP. vip1-van4 970289 n/a 970295 unspecified role unspecified role prey prey n/a 970292 unspecified role unspecified role bait bait physical association physical association false false false Table 1. VIP1 interacted with Vanabins 1-4 but not with VanabinP. van1-vip1-3 970289 n/a 970293 unspecified role unspecified role bait bait n/a 970292 unspecified role unspecified role prey prey n terminal sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 1. VIP1 interacted with Vanabins 1-4 but not with VanabinP. van1-van1 970289 n/a 970293 unspecified role unspecified role prey prey n/a 970293 unspecified role unspecified role bait bait physical association physical association false false false Table 1. VIP1 interacted with Vanabins 1-4 but not with VanabinP. van1-van2 970289 n/a 970291 unspecified role unspecified role prey prey n/a 970293 unspecified role unspecified role bait bait physical association physical association false false false Table 1. VIP1 interacted with Vanabins 1-4 but not with VanabinP. van1-van3 970289 n/a 970294 unspecified role unspecified role prey prey n/a 970293 unspecified role unspecified role bait bait physical association physical association false false false Table 1. VIP1 interacted with Vanabins 1-4 but not with VanabinP. van1-van4 970289 n/a 970295 unspecified role unspecified role prey prey n/a 970293 unspecified role unspecified role bait bait physical association physical association false false false Table 1. VIP1 interacted with Vanabins 1-4 but not with VanabinP. van3-van1 970289 n/a 970293 unspecified role unspecified role prey prey n/a 970294 unspecified role unspecified role bait bait physical association physical association false false false Table 1. VIP1 interacted with Vanabins 1-4 but not with VanabinP. van3-vip1 970289 n/a 970294 unspecified role unspecified role bait bait n/a 970292 unspecified role unspecified role prey prey n terminal sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 1. VIP1 interacted with Vanabins 1-4 but not with VanabinP. van4-vip1-1 970289 n/a 970295 unspecified role unspecified role bait bait n/a 970292 unspecified role unspecified role prey prey n terminal sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Table 1. VIP1 interacted with Vanabins 1-4 but not with VanabinP. van4-van1 970289 n/a 970295 unspecified role unspecified role bait bait n/a 970293 unspecified role unspecified role prey prey physical association physical association false false false Table 1. VIP1 interacted with Vanabins 1-4 but not with VanabinP. van2-vip1 970290 n/a 970292 unspecified role unspecified role prey prey n/a 970291 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false (Fig 2) One of the clones isolated from a blood cell cDNA library of A. sydneiensis samea.