DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ brown-2008-3 in vitro In vitro crosslink cross-linking study crosslink weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Brown MR., Clark KD., Gulia M., Zhao Z., Garczynski SF., Crim JW., Suderman RJ., Strand MR. DIP original experiment: DIP-68650X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx An insulin-like peptide regulates egg maturation and metabolism in the mosquito Aedes aegypti. Brown MR., Clark KD., Gulia M., Zhao Z., Garczynski SF., Crim JW., Suderman RJ., Strand MR. Only protein-protein interactions imex curation insr_aedae Insulin-like receptor InR AAEL002317 protein protein aedae Aedes aegypti (Yellowfever mosquito) Culex aegypti Yellowfever mosquito MVSLLLFSILVVPVAVVQGDEMKAGQVGPVPKGGVCGSVDVRNSPAHLDRLKDCVVVEGFVHILLIDKYIDSSFENYSFPLLTEITEYLLLFRVNGLKSLRRLFPNLAVIRGDALVGDYAMVIYELMHIEEIGLISLMDITRGGVRIEKNPKLCFANTIDWKAMTVPGTNNYIKDNQKDNVCPICPAESTAVMLPNGSKQKCPAAPVRGGNKDHKRTLCWNANHCQTICPPECPKACSKTGVCCDAESCLGGCNLPNTSSCSVCRHLSIDPAGKRQCVAKCPPNTFKYHTRCVTRDECYAMKKPISLDSNPDLPDQPFIPHNGSCLMECPLDHELITELNKTRWCRKCSGTCPKRCEGSNIDNIQSAQLLKGCEIIDGSLEIQLRSRGGENIVKELENFLSSITEIKGYLKVVRSYPLLSLGFLKKLKIIHGKGNKVSNSSLYVVENQNLQELFDHNVTIGEGKLFFFNNPMLCTDRIKAVKKYNPGIEIENESQLESNNGDRAACSITELETSLKSIGSETAIIQWAPFTELSDARMLLGYVIYYIEAPYANVTFFDGRDACNTEGWRLDDISDFNMDKETTKILTQLKPYTQYAYYVKTYTLGSEGLGGQSKIKYFTTAPGTPSVVRDVEVSVNKNMLTVKWLPPLKMNGRLKEYEVFIELNADDNEQLMLRDYCEDDKLRDIVPETPTSAPPPKTSICTADQCRNYCKAPTSGGSTGTIDVTDKENQITFEDQLHNYVYIKNPLLRDKTTRRKRSTNLLFPNNTENKKNDTTDRRTEKVKDEPYYQYIFNATNETSITFPLSYFNHYSLYVFKIRACRHPGDPPAPSVRLVDVELACGNEVFENFRTPKKEGADDIPPESILIEEQSNNTQRQIRVQWKEPSKPNGPIVKFVVKYQRVDLESVSSTDICIRYSSFNQTRGALLTKLEPGNYSIRVMATTIAGDGAPSAARYVLIAKDDSMGTTLIWLGTLIVIFLCSVGFVAFYWYKYRYMSKQIRMYPEVNPDYAGVQYKVDDWEVERNHIIQLEELGQGSFGMVYKGILTQLRGEKCNQPCAIKTVNESATAREKDSFLLEASVMKQFNTHHVVRLLGVVSQGDPTLVIMELMANGDLKSYLRRHRPDYENGEDPSPQPPTLRQIIQMAIEIADGMAYLSAKKFVHRDLAARNCMVADDMTVKIGDFGMTRDIYETDYYRKGTKGFLPVRWMAPESLKDGIFSSSSDVFSYGVVLWEMATLASQPYQGLTNDQVLRYVIDGGVMERPENCPDNLYNLMRRCWQHRPTARPTFMEIISELLPDASPHFQDVAFYNSQDALDMLRGQHQTVIIDEATTPLRPGDDHDEEPGEDDDLVGHGEGHIGDVGTDDEFSMEMTNSHLVRNNGPMATIRSPHSPLR a0ezr6_aedae protein protein aedae Aedes aegypti (Yellowfever mosquito) Culex aegypti Yellowfever mosquito MSSTNLRVSSHLGLGSTMMHWGLMVLMVGTVVQAADQRFCGKQLVLTLSMLCDEFPDLHYGAKKSLNDYDKDYSTDEWLAMIGQDPESIVSTDLMVPHMDQQTVQQQQKVPLWMAMMYPQGYGFRSSASRNDLIPPRFRKSPRGIVDECCLRPCSINQLLKYCKTIA a0ezr6_aedae-inr-1 3170334 N/A 3170335 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3170336 unspecified role unspecified role unspecified role unspecified role aedae Aedes aegypti (Yellowfever mosquito) Culex aegypti Yellowfever mosquito physical association physical association false false false IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ cheng-2010b-6 A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. aedae-salivary_gland Aedes aegypti (Yellowfever mosquito) salivary gland Culex aegypti salivary_gland Salivary gland fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation cheng-2010b-1 A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation cheng-2010b-2 A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. aedae-hemocyte Aedes aegypti (Yellowfever mosquito) hemocyte Culex aegypti hemocyte Hemocyte fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation cheng-2010b-3 A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation cheng-2010b-4 A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. A stable cell line was generated to express mosPTP-1 in S2 cells. Purified mosGCTL-1 was inoculated with mosPTP-1-expressing cells. An empty DNA vector transfected stable S2 cell line was used as the control.mosPTP-1 was stained by Alexa-488; mosGCTL-1 was stained by Phycoerythrin. erol.fikrig@yale.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation cheng-2010b-5 A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. confocal microscopy confocal microscopy immunostaining immunostaining Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation cheng-2010b-7 A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation q16k62_aedae Protein-tyrosine-phosphatase AAEL013105 protein protein aedae Aedes aegypti (Yellowfever mosquito) Culex aegypti Yellowfever mosquito MKTRLLTTLTWLALVQVLVVLVNHRGCALATVNLTESNGSTPYVVSEPEIPYEELEEPRVLPLQALPVSVKASSSESPNGADADIRNKHRFNQNIHGPDQPHADINTVLKVILEEPEINDEPFTTTHGYPTFSAYDNIVPSKPLNLSVLEVTSTTIKITWREPEKLNGAIHGYRVYYVHQNQTLLHLPILKADAAVNSVYTYTLSNLKPYTDYKIIVAAFTKKFDGEPSEVSQRTDISGPSAPKVVNLTCHSQHELLFGWHIPQTYYNTIDYYIISYRNLEHSEYKDIRLSANSSIVETSMIIPNLTTNMVYEVKVRAASASVINPKQIILGSYSEPKKISLQLHCEKIPQPSQRQVYDDYNLAVLGGIVFSCFGLLLIVLSFLLWKKCFHAAYYYLDDPPACQGANTAGLIDWEAPCEVAGEVRGPIPVTEFAKHVASLHVDGDIGFSKEYEAIQGEALNDEYPSEHSQHPDNKGKNRYLNVIAYDHSRVHLRQVPGQKKHLDYINANYIDGYQRPRSFIGTQGPLPGTFDCFWRMIWEQRVAIIVMITNLVERGRRKCDMYWPKDGAEMYGVIQVRLIREDVMATYTVRTLQIKHTKLKKKKASQSEKLVYQYHYTNWPDHGTPDHPLPVINFVKKSTAANPSDAGPIVVHCSAGVGRTGTYIVLDAMLKQIESKGMLNVFGFLRYIRAQRNYLVQTEEQYIFIHDALVEAIDSGETNIKMDAIGGLVNNIDFIDNQYKLITSYQPKEINLTSALKSVNAIKNRSSLVPLEGSRVHLTPKPGVEGSDYINASWLHGFRRLRDFVVTQHPLIETFKDFWQMVWDHNAQTVVLLSSADNMSFLQFWPNESEPMESDYYRIRMVSETSENNYIVRNFVIQSIQDDYELSVRMFENPMWPDMANPRSIYDFAVRVHERCAQYRNGPIVVVDRYHWKYF p06935-pro_0000037746 Envelope protein E protein protein wnv West Nile virus (WNV) FNCLGMSNRDFLEGVSGATWVDLVLEGDSCVTIMSKDKPTIDVKMMNMEAANLADVRSYCYLASVSDLSTRAACPTMGEAHNEKRADPAFVCKQGVVDRGWGNGCGLFGKGSIDTCAKFACTTKATGWIIQKENIKYEVAIFVHGPTTVESHGKIGATQAGRFSITPSAPSYTLKLGEYGEVTVDCEPRSGIDTSAYYVMSVGEKSFLVHREWFMDLNLPWSSAGSTTWRNRETLMEFEEPHATKQSVVALGSQEGALHQALAGAIPVEFSSNTVKLTSGHLKCRVKMEKLQLKGTTYGVCSKAFKFARTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPVGRLVTVNPFVSVATANSKVLIELEPPFGDSYIVVGRGEQQINHHWHKSGSSIGKAFTTTLRGAQRLAALGDTAWDFGSVGGVFTSVGKAIHQVFGGAFRSLFGGMSWITQGLLGALLLWMGINARDRSIAMTFLAVGGVLLFLSVNVHA 291 787 q17nz6_aedae CTLMA15 5563672 AAEL000563 protein protein aedae Aedes aegypti (Yellowfever mosquito) Culex aegypti Yellowfever mosquito MLTKGITLILLLVLVHSSHGDSTPNRKFYIPSIRANWFKANEFCNSLKMRLVAIRSQEDNDAVARYVRTTSKFTDNCSFWIGASDLADEGTFVWVATGEEVTYTNWRENEPNNEGGNEDCIQLAYIPALNYHWSWNDNTCAGQSLYFICESVECDCVQPF gctl1-e_wnv-3 978349 n/a 978356 unspecified role unspecified role neutral component neutral component n/a 978357 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Supp. Fig. 3E gctl1-e_wnv-4 978349 n/a 978356 unspecified role unspecified role neutral component neutral component n/a 978357 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 978358 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 5D gctl1-e_wnv-1 978350 n/a 978356 unspecified role unspecified role bait bait n/a 978357 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction false false false Interaction is calcium-dependent. Fig. 3B gctl1-e_wnv-2 978351 n/a 978357 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 978356 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 3E gctl1-ptp1-1 978352 n/a 978358 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 978357 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction false false false Fig. 3D gctl1-ptp1-2 978353 n/a 978358 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 978357 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association false false false Fig. 3E gctl1-ptp1-3 978354 n/a 978358 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 978357 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. colocalization colocalization false false false Fig. 4F gctl1-e_wnv-5 978355 n/a 978357 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. n/a 978356 unspecified role unspecified role prey prey direct interaction direct interaction false false false mosGCTL-1 antisera blocked the interaction between mosGCTL-1 and WNV E protein. Fig. 6A MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint calvo-2010a-1 Aegyptin displays high-affinity for the von Willebrand factor binding site (RGQOGVMGF) in collagen and inhibits carotid thrombus formation in vivo. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Calvo E., Tokumasu F., Mizurini DM., McPhie P., Narum DL., Ribeiro JM., Monteiro RQ., Francischetti IM. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation calvo-2010a-4 Aegyptin displays high-affinity for the von Willebrand factor binding site (RGQOGVMGF) in collagen and inhibits carotid thrombus formation in vivo. in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined Calvo E., Tokumasu F., Mizurini DM., McPhie P., Narum DL., Ribeiro JM., Monteiro RQ., Francischetti IM. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation calvo-2010a-2 Aegyptin displays high-affinity for the von Willebrand factor binding site (RGQOGVMGF) in collagen and inhibits carotid thrombus formation in vivo. in vitro In vitro fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Calvo E., Tokumasu F., Mizurini DM., McPhie P., Narum DL., Ribeiro JM., Monteiro RQ., Francischetti IM. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation calvo-2010a-3 Aegyptin displays high-affinity for the von Willebrand factor binding site (RGQOGVMGF) in collagen and inhibits carotid thrombus formation in vivo. in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Calvo E., Tokumasu F., Mizurini DM., McPhie P., Narum DL., Ribeiro JM., Monteiro RQ., Francischetti IM. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation all3_aedae 30 kDa salivary gland allergen Aed a 3 AAEL010235 protein protein aedae Aedes aegypti (Yellowfever mosquito) Culex aegypti Yellowfever mosquito MKPLVKLFLLFCLVGIVLSRPMPEDEEPVAEGGDDDASGESEGEEETTDDAGGDGGEEENEGEEHAGDKDAGGEDTGKEENTGHDDAGEEDAGEEDAGEEDAGEEDAGEEDAEKEEGEKEDAGDDAGSDDGEEDSTGGDEGEDNAEDSKGSEKNDPADTYRQVVALLDKDTKVDHIQSEYLRSALNNDLQSEVRVPVVEAIGRIGDYSKIQGCFKSMGKDVKKVISEEEKKFKSCMSKKKSEYQCSEDSFAAAKSKLSPITSKIKSCVSSKGR mint co3a1_human Collagen alpha-1(III) chain COL3A1 protein protein human Homo sapiens Human MMSFVQKGSWLLLALLHPTIILAQQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYSPQYDSYDVKSGVAVGGLAGYPGPAGPPGPPGPPGTSGHPGSPGSPGYQGPPGEPGQAGPSGPPGPPGAIGPSGPAGKDGESGRPGRPGERGLPGPPGIKGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGENGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGAPGQRGEPGPQGHAGAQGPPGPPGINGSPGGKGEMGPAGIPGAPGLMGARGPPGPAGANGAPGLRGGAGEPGKNGAKGEPGPRGERGEAGIPGVPGAKGEDGKDGSPGEPGANGLPGAAGERGAPGFRGPAGPNGIPGEKGPAGERGAPGPAGPRGAAGEPGRDGVPGGPGMRGMPGSPGGPGSDGKPGPPGSQGESGRPGPPGPSGPRGQPGVMGFPGPKGNDGAPGKNGERGGPGGPGPQGPPGKNGETGPQGPPGPTGPGGDKGDTGPPGPQGLQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPGLAGAPGLRGGAGPPGPEGGKGAAGPPGPPGAAGTPGLQGMPGERGGLGSPGPKGDKGEPGGPGADGVPGKDGPRGPTGPIGPPGPAGQPGDKGEGGAPGLPGIAGPRGSPGERGETGPPGPAGFPGAPGQNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGPAGPPGPQGVKGERGSPGGPGAAGFPGARGLPGPPGSNGNPGPPGPSGSPGKDGPPGPAGNTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLGIAGITGARGLAGPPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPGPQGLPGLAGTAGEPGRDGNPGSDGLPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGESGPAGPAGAPGPAGSRGAPGPQGPRGDKGETGERGAAGIKGHRGFPGNPGAPGSPGPAGQQGAIGSPGPAGPRGPVGPSGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDSSAEKKHVWFGESMDGGFQFSYGNPELPEDVLDVHLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCFL co1a1_human Collagen alpha-1(I) chain Alpha-1 type I collagen COL1A1 protein protein human Homo sapiens Human MFSFVDLRLLLLLAATALLTHGQEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKSTGGISVPGPMGPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGPRGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPGGPPGPKGNSGEPGAPGSKGDTGAKGEPGPVGVQGPPGPAGEEGKRGARGEPGPTGLPGPPGERGGPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGVPGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGDKGESGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGPPGPAGPAGPPGPIGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPAGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGVVGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPTGPVGPVGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQGSNEIEIRAEGNSRFTYSVTVDGCTSHTGAWGKTVIEYKTTKTSRLPIIDVAPLDVGAPDQEFGFDVGPVCFL col1a1-all3 862725 all3_aedae Aegyptin 862729 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified co1a1_human Collagen 862730 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false F2B mint col1a1-all3-1 862725 all3_aedae Aegyptin 862729 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified co1a1_human Collagen 862730 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false 862725 F2A mint col1a1-all3-2 862725 all3_aedae Aegyptin 862729 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal false co1a1_human Collagen 862730 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false 862725 F5c mint col3a1-all3 862726 all3_aedae Aegyptin 862729 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified co3a1_human Collagen 862731 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false F3E mint col3a1-all3-1 862726 all3_aedae Aegyptin 862729 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified co3a1_human Collagen 862731 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false mint F3E F3C F3D col1a1-all3-3 862727 all3_aedae Aegyptin 862729 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified co1a1_human Collagen 862730 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false F2D mint col1a1-all3-4 862728 all3_aedae Aegyptin 862729 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified co1a1_human Collagen 862730 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false 862728 F2C mint