DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ fuentes_prior-1997-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Fuentes-Prior P., Noeske-Jungblut C., Donner P., Schleuning WD., Huber R., Bode W. Wolfram Bode Proceedings of the National Academy of Sciences of the United States of America 1997 Only protein-protein interactions imex curation imex curation q27049-pro_0000017994 Triabin protein protein Triatomine bug Meccus pallidipennis Triatoma pallidipennis AEGDDCSIEKAMGDFKPEEFFNGTWYLAHGPGVTSPAVCQKFTTSGSKGFTQIVEIGYNKFESNVKFQCNQVDNKNGEQYSFKCKSSDNTEFEADFTFISVSYDNFALVCRSITFTSQPKEDDYLVLERTKSDTDPDAKEIC 19 160 pro_0000028157 Thrombin light chain F2 protein protein bovin Bos taurus (Bovine) Bovine TSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR pro_0000028158 Thrombin heavy chain F2 protein protein bovin Bos taurus (Bovine) Bovine IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDRLGS f2-f2-3 3579065 N/A 3579066 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified 9inse 9inse Stoichiometry: 1.0 N/A 3579067 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified 9inse 9inse Stoichiometry: 1.0 N/A 3579068 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified 9inse 9inse Stoichiometry: 1.0 physical association physical association false false false Fig 1, Table 1