UniProt UniProt http://www.uniprot.org igelmann-2021-6 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column experimental particp experimental participant identification experimental particp Igelmann S., Lessard F., Uchenunu O., Bouchard J., Fernandez-Ruiz A., Rowell MC., Lopes-Paciencia S., Papadopoli D., Fouillen A., Ponce KJ., Huot G., Mignacca L., Benfdil M., Kalegari P., Wahba HM., Pencik J., Vuong N., Quenneville J., Guillon J., Bourdeau V., Hulea L., Gagnon E., Kenner L., Moriggl R., Nanci A., Pollak MN., Omichinski JG., Topisirovic I., Ferbeyre G. All proteins were purified in three steps; first by metal affinity chromatography followed by ion-exchange chromatography and then size-exclusion chromatography Species of MDH1 and PYC constructs confirmed by the authors g.ferbeyre@umontreal.ca Molecular cell 2021 Only protein-protein interactions imex curation imex curation igelmann-2021-4 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Igelmann S., Lessard F., Uchenunu O., Bouchard J., Fernandez-Ruiz A., Rowell MC., Lopes-Paciencia S., Papadopoli D., Fouillen A., Ponce KJ., Huot G., Mignacca L., Benfdil M., Kalegari P., Wahba HM., Pencik J., Vuong N., Quenneville J., Guillon J., Bourdeau V., Hulea L., Gagnon E., Kenner L., Moriggl R., Nanci A., Pollak MN., Omichinski JG., Topisirovic I., Ferbeyre G. Species of MDH1 and PYC constructs confirmed by the authors g.ferbeyre@umontreal.ca Molecular cell 2021 Only protein-protein interactions imex curation imex curation igelmann-2021-3 human-imr_90 Homo sapiens embryonic fetal lung fibroblast imr_90 human, Caucasian female 16 fetal weeks; Tissue: lung, embryonic fibroblast pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Igelmann S., Lessard F., Uchenunu O., Bouchard J., Fernandez-Ruiz A., Rowell MC., Lopes-Paciencia S., Papadopoli D., Fouillen A., Ponce KJ., Huot G., Mignacca L., Benfdil M., Kalegari P., Wahba HM., Pencik J., Vuong N., Quenneville J., Guillon J., Bourdeau V., Hulea L., Gagnon E., Kenner L., Moriggl R., Nanci A., Pollak MN., Omichinski JG., Topisirovic I., Ferbeyre G. Species of MDH1 and PYC constructs confirmed by the authors g.ferbeyre@umontreal.ca Molecular cell 2021 Only protein-protein interactions imex curation imex curation igelmann-2021-1 human-imr_90 Homo sapiens embryonic fetal lung fibroblast imr_90 human, Caucasian female 16 fetal weeks; Tissue: lung, embryonic fibroblast confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Igelmann S., Lessard F., Uchenunu O., Bouchard J., Fernandez-Ruiz A., Rowell MC., Lopes-Paciencia S., Papadopoli D., Fouillen A., Ponce KJ., Huot G., Mignacca L., Benfdil M., Kalegari P., Wahba HM., Pencik J., Vuong N., Quenneville J., Guillon J., Bourdeau V., Hulea L., Gagnon E., Kenner L., Moriggl R., Nanci A., Pollak MN., Omichinski JG., Topisirovic I., Ferbeyre G. Species of MDH1 and PYC constructs confirmed by the authors g.ferbeyre@umontreal.ca Molecular cell 2021 Only protein-protein interactions imex curation imex curation igelmann-2021-11 mouse-prostate Mus musculus prostate Mouse prostate prostate pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Igelmann S., Lessard F., Uchenunu O., Bouchard J., Fernandez-Ruiz A., Rowell MC., Lopes-Paciencia S., Papadopoli D., Fouillen A., Ponce KJ., Huot G., Mignacca L., Benfdil M., Kalegari P., Wahba HM., Pencik J., Vuong N., Quenneville J., Guillon J., Bourdeau V., Hulea L., Gagnon E., Kenner L., Moriggl R., Nanci A., Pollak MN., Omichinski JG., Topisirovic I., Ferbeyre G. Prostate carcinoma cells Species of MDH1 and PYC constructs confirmed by the authors g.ferbeyre@umontreal.ca Molecular cell 2021 Only protein-protein interactions imex curation imex curation igelmann-2021-2 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Igelmann S., Lessard F., Uchenunu O., Bouchard J., Fernandez-Ruiz A., Rowell MC., Lopes-Paciencia S., Papadopoli D., Fouillen A., Ponce KJ., Huot G., Mignacca L., Benfdil M., Kalegari P., Wahba HM., Pencik J., Vuong N., Quenneville J., Guillon J., Bourdeau V., Hulea L., Gagnon E., Kenner L., Moriggl R., Nanci A., Pollak MN., Omichinski JG., Topisirovic I., Ferbeyre G. Species of MDH1 and PYC constructs confirmed by the authors g.ferbeyre@umontreal.ca Molecular cell 2021 Only protein-protein interactions imex curation imex curation igelmann-2021-5 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Igelmann S., Lessard F., Uchenunu O., Bouchard J., Fernandez-Ruiz A., Rowell MC., Lopes-Paciencia S., Papadopoli D., Fouillen A., Ponce KJ., Huot G., Mignacca L., Benfdil M., Kalegari P., Wahba HM., Pencik J., Vuong N., Quenneville J., Guillon J., Bourdeau V., Hulea L., Gagnon E., Kenner L., Moriggl R., Nanci A., Pollak MN., Omichinski JG., Topisirovic I., Ferbeyre G. MDH1 and PC were purified in three steps; first by metal affinity chromatography followed by ion-exchange chromatography and then size-exclusion chromatography. GST-tagged ME1 was purified, then the tag removed. Species of MDH1 and PYC constructs confirmed by the authors g.ferbeyre@umontreal.ca Molecular cell 2021 Only protein-protein interactions imex curation imex curation igelmann-2021-7 human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Igelmann S., Lessard F., Uchenunu O., Bouchard J., Fernandez-Ruiz A., Rowell MC., Lopes-Paciencia S., Papadopoli D., Fouillen A., Ponce KJ., Huot G., Mignacca L., Benfdil M., Kalegari P., Wahba HM., Pencik J., Vuong N., Quenneville J., Guillon J., Bourdeau V., Hulea L., Gagnon E., Kenner L., Moriggl R., Nanci A., Pollak MN., Omichinski JG., Topisirovic I., Ferbeyre G. Species of MDH1 and PYC constructs confirmed by the authors g.ferbeyre@umontreal.ca Molecular cell 2021 Only protein-protein interactions imex curation imex curation igelmann-2021-8 human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma pull down pull down western blot western blot Immuno blot Immuno blot Igelmann S., Lessard F., Uchenunu O., Bouchard J., Fernandez-Ruiz A., Rowell MC., Lopes-Paciencia S., Papadopoli D., Fouillen A., Ponce KJ., Huot G., Mignacca L., Benfdil M., Kalegari P., Wahba HM., Pencik J., Vuong N., Quenneville J., Guillon J., Bourdeau V., Hulea L., Gagnon E., Kenner L., Moriggl R., Nanci A., Pollak MN., Omichinski JG., Topisirovic I., Ferbeyre G. Species of MDH1 and PYC constructs confirmed by the authors g.ferbeyre@umontreal.ca Molecular cell 2021 Only protein-protein interactions imex curation imex curation igelmann-2021-9 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma pull down pull down western blot western blot Immuno blot Immuno blot Igelmann S., Lessard F., Uchenunu O., Bouchard J., Fernandez-Ruiz A., Rowell MC., Lopes-Paciencia S., Papadopoli D., Fouillen A., Ponce KJ., Huot G., Mignacca L., Benfdil M., Kalegari P., Wahba HM., Pencik J., Vuong N., Quenneville J., Guillon J., Bourdeau V., Hulea L., Gagnon E., Kenner L., Moriggl R., Nanci A., Pollak MN., Omichinski JG., Topisirovic I., Ferbeyre G. Species of MDH1 and PYC constructs confirmed by the authors g.ferbeyre@umontreal.ca Molecular cell 2021 Only protein-protein interactions imex curation imex curation igelmann-2021-10 human-imr_90 Homo sapiens embryonic fetal lung fibroblast imr_90 human, Caucasian female 16 fetal weeks; Tissue: lung, embryonic fibroblast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Igelmann S., Lessard F., Uchenunu O., Bouchard J., Fernandez-Ruiz A., Rowell MC., Lopes-Paciencia S., Papadopoli D., Fouillen A., Ponce KJ., Huot G., Mignacca L., Benfdil M., Kalegari P., Wahba HM., Pencik J., Vuong N., Quenneville J., Guillon J., Bourdeau V., Hulea L., Gagnon E., Kenner L., Moriggl R., Nanci A., Pollak MN., Omichinski JG., Topisirovic I., Ferbeyre G. Species of MDH1 and PYC constructs confirmed by the authors g.ferbeyre@umontreal.ca Molecular cell 2021 Only protein-protein interactions imex curation imex curation igelmann-2021-12 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot Igelmann S., Lessard F., Uchenunu O., Bouchard J., Fernandez-Ruiz A., Rowell MC., Lopes-Paciencia S., Papadopoli D., Fouillen A., Ponce KJ., Huot G., Mignacca L., Benfdil M., Kalegari P., Wahba HM., Pencik J., Vuong N., Quenneville J., Guillon J., Bourdeau V., Hulea L., Gagnon E., Kenner L., Moriggl R., Nanci A., Pollak MN., Omichinski JG., Topisirovic I., Ferbeyre G. Species of MDH1 and PYC constructs confirmed by the authors g.ferbeyre@umontreal.ca Molecular cell 2021 Only protein-protein interactions imex curation imex curation pyc_human Pyruvate carboxylase, mitochondrial PC Pyruvic carboxylase protein protein human Homo sapiens Human MLKFRTVHGGLRLLGIRRTSTAPAASPNVRRLEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAIYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENNVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPAAHLDPQLRTRLTSDSVKLAKQVGYENAGTVEFLVDRHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVAEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIAFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIPVKASPSPTDPVVPAVPIGPPPAGFRDILLREGPEGFARAVRNHPGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFSKLFSMENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNVVFKFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVADPSRTKYSLQYYMGLAEELVRAGTHILCIKDMAGLLKPTACTMLVSSLRDRFPDLPLHIHTHDTSGAGVAAMLACAQAGADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQMLGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGVPHGGFPEPFRSKVLKDLPRVEGRPGASLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVVAGAKVAKGQPLCVLSAMKMETVVTSPMEGTVRKVHVTKDMTLEGDDLILEIE maox_human NADP-dependent malic enzyme ME1 Malic enzyme 1 protein protein human Homo sapiens Human MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ mdhc_human Malate dehydrogenase, cytoplasmic Cytosolic malate dehydrogenase MDH1 MDHA Diiodophenylpyruvate reductase protein protein human Homo sapiens Human MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA nadh(2-) NADH(2-) NADH NADH dianion adenosine 5'-{3-[1-(3-carbamoyl-1,4-dihydropyridin-1-yl)-1,4-anhydro-D-ribitol-5-yl] diphosphate} small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) stat3_human Signal transducer and activator of transcription 3 Acute-phase response factor STAT3 APRF protein protein human Homo sapiens Human MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM 6C00632211C8012D atd3a_human ATPase family AAA domain-containing protein 3A ATAD3A protein protein human Homo sapiens Human MSWLFGINKGPKGEGAGPPPPLPPAQPGAEGGGDRGLGDRPAPKDKWSNFDPTGLERAAKAARELEHSRYAKDALNLAQMQEQTLQLEQQSKLKMRLEALSLLHTLVWAWSLCRAGAVQTQERLSGSASPEQVPAGECCALQEYEAAVEQLKSEQIRAQAEERRKTLSEETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAMRRATVEREMELRHKNEMLRVEAEARARAKAERENADIIREQIRLKAAEHRQTVLESIRTAGTLFGEGFRAFVTDWDKVTATVAGLTLLAVGVYSAKNATLVAGRFIEARLGKPSLVRETSRITVLEALRHPIQVSRRLLSRPQDALEGVVLSPSLEARVRDIAIATRNTKKNRSLYRNILMYGPPGTGKTLFAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLYRTGQHSNKFMLVLASNQPEQFDWAINDRINEMVHFDLPGQEERERLVRMYFDKYVLKPATEGKQRLKLAQFDYGRKCSEVARLTEGMSGREIAQLAVSWQATAYASEDGVLTEAMMDTRVQDAVQQHQQKMCWLKAEGPGRGDEPSPS pyc_mouse Pyruvate carboxylase, mitochondrial Pyruvic carboxylase Pc Pcx protein protein mouse Mus musculus Mouse MLKFQTVRGGLRLLGVRRSSSAPVASPNVRRLEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENGVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDSPISSLHEAHEFSNTFGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPATHLDPQLRSRLTSDSVKLAKQVGYENAGTVEFLVDKHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVSEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIPFLQNVLNNQQFLAGTVDTQFIDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIPVNVSPSPVDPAVPVVPIGPPPAGFRDILLREGPEGFARAVRNHQGLLLMDTTFRDAHQSLLATRVRTHDLKKIAPYVAHNFNKLFSMENWGGATFDVAMRFLYECPWRRLQELRELIPNIPFQMLLRGANAVGYTNYPDNVVFKFCEVAKENGMDVFRVFDSLNYLPNMLLGMEAAGSAGGVVEAAISYTGDVADPSRTKYSLEYYMGLAEELVRAGTHILCIKDMAGLLKPAACTMLVSSLRDRFPDLPLHIHTHDTSGAGVAAMLACAQAGADVVDVAVDSMSGMTSQPSMGALVACTKGTPLDTEVPLERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQMLGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGIPHGGFPEPFRSKVLKDLPRIEGRPGASLPPLNLKELEKDLIDRHGEEVTPEDVLSAAMYPDVFAQFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVAAGDKVAKGQPLCVLSAMKMETVVTSPMEGTIRKVHVTKDMTLEGDDLILEIE mdhc_mouse Malate dehydrogenase, cytoplasmic Cytosolic malate dehydrogenase Mdh1 Mor2 protein protein mouse Mus musculus Mouse MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIATDKEEIAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGTALEKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAIADHIRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKETAFEFLSSA maox_mouse NADP-dependent malic enzyme Me1 Malic enzyme 1 Mod-1 Mod1 protein protein mouse Mus musculus Mouse MEPRAPRRRHTHQRGYLLTRDPHLNKDLAFTLEERQQLNIHGLLPPCIISQELQVLRIIKNFERLNSDFDRYLLLMDLQDRNEKLFYSVLMSDVEKFMPIVYTPTVGLACQQYSLAFRKPRGLFISIHDKGHIASVLNAWPEDVVKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCLPITLDVGTENEELLKDPLYIGLRHRRVRGPEYDAFLDEFMEAASSKYGMNCLIQFEDFANRNAFRLLNKYRNKYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTVLFQGAGEAALGIAHLVVMAMEKEGLSKENARKKIWLVDSKGLIVKGRASLTEEKEVFAHEHEEMKNLEAIVQKIKPTALIGVAAIGGAFTEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKVTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTTAEVISQQVSDKHLQEGRLYPPLNTIRGVSLKIAVKIVQDAYKEKMATVYPEPQNKEEFVSSQMYSTNYDQILPDCYPWPAEVQKIQTKVNQ syj2b_rat Synaptojanin-2-binding protein Synj2bp Omp25 Mitochondrial outer membrane protein 25 NPW16 protein protein rat Rattus norvegicus (Rat) Rat MNGRVDYLVSEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKEDGAAARDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLPVQNGPIVHRGDGEPSGVPVAVVLLPVFALTLVAVWAFVRYRKQL mint tom20_human Mitochondrial import receptor subunit TOM20 homolog Outer mitochondrial membrane receptor Tom20 TOMM20 KIAA0016 Mitochondrial 20 kDa outer membrane protein protein protein human Homo sapiens Human MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE pc-mdh1-3 4100534 N/A 4100546 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 8.0 N/A 4100547 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 8.0 N/A 4100548 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 N/A 4100549 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 3E, Supp. Figs 5K-M Mol wt.=1Mda me1-1 4100534 N/A 4100547 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Fig. 3E, Supp. Figs 5K-M me1-4 4100534 N/A 4100547 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 direct interaction direct interaction false false false Fig, 3E Supp. Figs. 5K-M mdh1-1 4100534 N/A 4100548 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Fig. 3E, Supp. Figs 5K-M pc-6 4100534 N/A 4100546 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 direct interaction direct interaction false false false Fig. 3E, Supp. Figs. 5K-M mdh1-me1-3 4100534 N/A 4100546 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 N/A 4100547 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 N/A 4100548 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 4100549 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 3E, Supp. Figs. 5K-M Mol wt.=590kDa me1-mdh1-2 4100535 N/A 4100546 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 4100547 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 4100548 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false association association false false false Fig. 2J, Supp. Figs. 5C, 5I pc-mdh1-1 4100535 N/A 4100546 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4100547 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 4100548 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 5B mdh1-me1-4 4100535 N/A 4100546 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 4100547 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4100548 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Figs. 5A, 5G me1-pc-1 4100535 N/A 4100546 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4100547 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Figs. 5C mdh1-me1-5 4100535 N/A 4100546 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4100547 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4100548 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false association association false false false Supp. Figs. 5A, 5H mdh1-me1-2 4100536 N/A 4100547 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4100548 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Fig. 2F Interaction observed in STAT3 and TP53 knockout cells me1-pc-2 4100536 N/A 4100547 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4100546 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Fig. 2F Interaction observed in STAT3 and TP53 knockout cells atad3a-stat3-1 4100536 N/A 4100550 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4100551 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Supp. Fig. 1P, 1S mdh1-me1-1 4100537 N/A 4100546 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell N/A 4100547 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell N/A 4100548 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false Fig. 2C-E, 7J, Supp. Fig. 4H Interaction observed in STAT3 and TP53 knockout cells. Cells expressing oncogenic RAS in 1% oxygen led to an increase in HTC foci formation compared with IMR90 RAS cells in normoxia. The foci were dissolved by 1,6-hexanediol, suggesting that they formed via liquid-liquid phase separation. mdh1-me1-6 4100537 N/A 4100546 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 4100547 anti-tag immunocytochemistry anti-tag immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4100548 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 2B, 7B, Supp Fig. 4G Interaction observed in STAT3 and TP53 knockout cells. Cells expressing oncogenic RAS in 1% oxygen led to an increase in HTC foci formation compared with IMR90 RAS cells in normoxia mdh1-me1-7 4100538 N/A 4100552 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4100553 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Fig. 6H Interaction observed in STAT3 and PTEN knockout cells me1-pc-3 4100538 N/A 4100554 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4100552 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Fig. 6H Interaction observed in STAT3 and PTEN knockout cells me1-mdh1-1 4100539 N/A 4100546 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell N/A 4100547 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4100548 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Fig. 2I Interaction observed in STAT3 and TP53 knockout cells pc-mdh1-2 4100540 N/A 4100546 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 4100547 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) N/A 4100548 unspecified role unspecified role prey prey purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) association association false false false Fig. 3C, 3D me1-mdh1-3 4100541 N/A 4100546 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4100547 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4100548 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Supp. Fig. 5D pc-mdh1-4 4100542 N/A 4100546 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4100547 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4100548 unspecified role unspecified role prey prey association association false false false Supp. Fig. 5E pc-mdh1-6 4100543 N/A 4100546 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4100547 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4100548 unspecified role unspecified role prey prey association association false false false Supp. Fig. 5F synj2bp-stat3-1 4100544 N/A 4100555 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4100550 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4100556 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Supp. Fig 1O Endogenous STAT3 was reduced in cells that undergo oncogene-induced senescence me1-mdh1-4 4100545 N/A 4100546 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4100547 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4100548 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Fig. 3A, 3B