IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kern-2021-1 spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 3d-em 3D electron microscopy 3D-EM electron tomog structure determination identification by structure determination identification by structure determination structure determination Kern DM., Sorum B., Mali SS., Hoel CM., Sridharan S., Remis JP., Toso DB., Kotecha A., Bautista DM., Brohawn SG. Virus - Publications including interactions involving viral proteins dbautista@berkeley.edu, brohawn@berkeley.edu Nature structural & molecular biology 2021 Only protein-protein interactions imex curation imex curation Kern DM., Sorum B., Mali SS., Hoel CM., Sridharan S., Remis JP., Toso DB., Kotecha A., Bautista DM., Brohawn SG., Kern DM., Sorum B., Mali SS., Hoel CM., Sridharan S., Remis JP., Toso DB., Kotecha A., Bautista DM., Brohawn SG. Coronavirus - Interactions investigated in the context of Coronavirus kern-2021-2 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog structure determination identification by structure determination identification by structure determination structure determination Kern DM., Sorum B., Mali SS., Hoel CM., Sridharan S., Remis JP., Toso DB., Kotecha A., Bautista DM., Brohawn SG. Virus - Publications including interactions involving viral proteins dbautista@berkeley.edu, brohawn@berkeley.edu Nature structural & molecular biology 2021 Only protein-protein interactions imex curation imex curation Kern DM., Sorum B., Mali SS., Hoel CM., Sridharan S., Remis JP., Toso DB., Kotecha A., Bautista DM., Brohawn SG., Kern DM., Sorum B., Mali SS., Hoel CM., Sridharan S., Remis JP., Toso DB., Kotecha A., Bautista DM., Brohawn SG. Coronavirus - Interactions investigated in the context of Coronavirus ap3a_sars2 ORF3a protein Accessory protein 3a Protein U274 Protein X1 3a Protein 3a protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASLPFGWLIVGVALLAVFQSASKIITLKKRWQLALSKGVHFVCNLLLLFVTVYSHLLLVAAGLEAPFLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL apoa1_human Apolipoprotein A-I APOA1 Apolipoprotein A1 protein protein human Homo sapiens Human MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ ap3a_sars2-9 4068512 N/A 4068514 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false Table 1 ap3a_sars2-10 4068513 N/A 4068515 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 4068514 unspecified role unspecified role neutral component neutral component purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection Stoichiometry: 2.0 direct interaction direct interaction false false false Table 1 ORF3a in Nanodiscs