IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ alexander-2021-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Alexander R. Leydon, Wei Wang2, Hardik P. Gala1, Sabrina Gilmour1, Samuel Juarez-Solis, Mollye L. Zahler1, Joseph E. Zemke, Ning Zheng, Jennifer L. Nemhauser 2021-05-28: Dr. Alexander R Leydon, University of Washington, Seattle , USA jn7@uw.edu Only protein-protein interactions imex curation imex curation Alexander R. Leydon, Wei Wang2, Hardik P. Gala1, Sabrina Gilmour1, Samuel Juarez-Solis, Mollye L. Zahler1, Joseph E. Zemke, Ning Zheng, Jennifer L. Nemhauser, Leydon AR., Wang W., Gala HP., Gilmour S., Juarez-Solis S., Zahler ML., Zemke JE., Zheng N., Nemhauser JL. eLife 2021 alexander-2021-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Alexander R. Leydon, Wei Wang2, Hardik P. Gala1, Sabrina Gilmour1, Samuel Juarez-Solis, Mollye L. Zahler1, Joseph E. Zemke, Ning Zheng, Jennifer L. Nemhauser 2021-05-28: Dr. Alexander R Leydon, University of Washington, Seattle , USA jn7@uw.edu Only protein-protein interactions imex curation imex curation Alexander R. Leydon, Wei Wang2, Hardik P. Gala1, Sabrina Gilmour1, Samuel Juarez-Solis, Mollye L. Zahler1, Joseph E. Zemke, Ning Zheng, Jennifer L. Nemhauser, Leydon AR., Wang W., Gala HP., Gilmour S., Juarez-Solis S., Zahler ML., Zemke JE., Zheng N., Nemhauser JL. eLife 2021 alexander-2021-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Alexander R. Leydon, Wei Wang2, Hardik P. Gala1, Sabrina Gilmour1, Samuel Juarez-Solis, Mollye L. Zahler1, Joseph E. Zemke, Ning Zheng, Jennifer L. Nemhauser 2021-05-28: Dr. Alexander R Leydon, University of Washington, Seattle , USA jn7@uw.edu Only protein-protein interactions imex curation imex curation Alexander R. Leydon, Wei Wang2, Hardik P. Gala1, Sabrina Gilmour1, Samuel Juarez-Solis, Mollye L. Zahler1, Joseph E. Zemke, Ning Zheng, Jennifer L. Nemhauser, Leydon AR., Wang W., Gala HP., Gilmour S., Juarez-Solis S., Zahler ML., Zemke JE., Zheng N., Nemhauser JL. eLife 2021 alexander-2021-3 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Alexander R. Leydon, Wei Wang2, Hardik P. Gala1, Sabrina Gilmour1, Samuel Juarez-Solis, Mollye L. Zahler1, Joseph E. Zemke, Ning Zheng, Jennifer L. Nemhauser 2021-05-28: Dr. Alexander R Leydon, University of Washington, Seattle , USA jn7@uw.edu Only protein-protein interactions imex curation imex curation Alexander R. Leydon, Wei Wang2, Hardik P. Gala1, Sabrina Gilmour1, Samuel Juarez-Solis, Mollye L. Zahler1, Joseph E. Zemke, Ning Zheng, Jennifer L. Nemhauser, Leydon AR., Wang W., Gala HP., Gilmour S., Juarez-Solis S., Zahler ML., Zemke JE., Zheng N., Nemhauser JL. eLife 2021 alexander-2021-4 nicbe-leaf Nicotiana benthamiana leaf leaf leaf anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Alexander R. Leydon, Wei Wang2, Hardik P. Gala1, Sabrina Gilmour1, Samuel Juarez-Solis, Mollye L. Zahler1, Joseph E. Zemke, Ning Zheng, Jennifer L. Nemhauser 2021-05-28: Dr. Alexander R Leydon, University of Washington, Seattle , USA jn7@uw.edu Only protein-protein interactions imex curation imex curation Alexander R. Leydon, Wei Wang2, Hardik P. Gala1, Sabrina Gilmour1, Samuel Juarez-Solis, Mollye L. Zahler1, Joseph E. Zemke, Ning Zheng, Jennifer L. Nemhauser, Leydon AR., Wang W., Gala HP., Gilmour S., Juarez-Solis S., Zahler ML., Zemke JE., Zheng N., Nemhauser JL. eLife 2021 alexander-2021-6 ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Alexander R. Leydon, Wei Wang2, Hardik P. Gala1, Sabrina Gilmour1, Samuel Juarez-Solis, Mollye L. Zahler1, Joseph E. Zemke, Ning Zheng, Jennifer L. Nemhauser 2021-05-28: Dr. Alexander R Leydon, University of Washington, Seattle , USA jn7@uw.edu Only protein-protein interactions imex curation imex curation Alexander R. Leydon, Wei Wang2, Hardik P. Gala1, Sabrina Gilmour1, Samuel Juarez-Solis, Mollye L. Zahler1, Joseph E. Zemke, Ning Zheng, Jennifer L. Nemhauser, Leydon AR., Wang W., Gala HP., Gilmour S., Juarez-Solis S., Zahler ML., Zemke JE., Zheng N., Nemhauser JL. eLife 2021 med21_arath Mediator of RNA polymerase II transcription subunit 21 Mediator complex subunit 21 RNAPII complex component SRB7 MED21 MED21_1 SRB7 T4B21.7 At4g04780 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDIISQLQEQVNTIAAITFNAFGTLQRDAPPVQLSPNYPEPPATTTVTDDATPFPEQPKQLSAGLVKAAKQFDALVAALPLSEGGEGAQLKRIAELQVENDLVGQELQKQLEAAEKELKQVQELFGQAADNCLNMKKPE tpl_arath Protein TOPLESS TPL WSIP1 WUS-interacting protein 1 F7H2.9 At1g15750 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEDEVHNGNWDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDKHDRPKAVDILVKDLKVFSTFNEELFKEITQLLTLENFRENEQLSKYGDTKSARAIMLVELKKLIEANPLFRDKLQFPTLRNSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHSCGPPNGARAPSPVNNPLLGGIPKAGGFPPLGAHGPFQPTASPVPTPLAGWMSSPSSVPHPAVSAGAIALGGPSIPAALKHPRTPPTNASLDYPSADSEHVSKRTRPMGISDEVNLGVNMLPMSFSGQAHGHSPAFKAPDDLPKTVARTLSQGSSPMSMDFHPIKQTLLLVGTNVGDIGLWEVGSRERLVQKTFKVWDLSKCSMPLQAALVKEPVVSVNRVIWSPDGSLFGVAYSRHIVQLYSYHGGEDMRQHLEIDAHVGGVNDISFSTPNKQLCVITCGDDKTIKVWDAATGVKRHTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNMGSRVDYDAPGRWCTTMAYSADGTRLFSCGTSKDGESFIVEWNESEGAVKRTYQGFHKRSLGVVQFDTTKNRYLAAGDDFSIKFWDMDAVQLLTAIDGDGGLQASPRIRFNKEGSLLAVSGNENVIKIMANSDGLRLLHTFENISSESSKPAINSIAAAAAAAATSAGHADRSANVVSIQGMNGDSRNMVDVKPVITEESNDKSKIWKLTEVSEPSQCRSLRLPENLRVAKISRLIFTNSGNAILALASNAIHLLWKWQRNERNATGKATASLPPQQWQPASGILMTNDVAETNPEEAVPCFALSKNDSYVMSASGGKISLFNMMTFKTMATFMPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAFSNVLNVLVSSGADAQLCVWNTDGWEKQRSKVLPLPQGRPNSAPSDTRVQFHQDQAHFLVVHETQLAIYETTKLECMKQWAVRESLAPITHATFSCDSQLVYASFMDATVCVFSSANLRLRCRVNPSAYLPASLSNSNVHPLVIAAHPQEPNMFAVGLSDGGVHIFEPLESEGKWGVAPPAENGSASGAPTAPSVGASASDQPQR md10b_arath Mediator of RNA polymerase II transcription subunit 10b MED10B MED10_1 T24P13.4 At1g26665 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPTQNTSAGIGGSNGTIRYQTNDGTSTVTVADDSKENLSQVINSIEKTLGVLHQLHLTVTSFTPASQLHLLQRLNSLVMELDNMTKLSEKCNIQIPMEVLNLIDDGKNPDEFTKDVLNSCIARNQVTKGKTDAFKDLRKHILEELEQNFPDEVDMYREIRASSAAVTKRLAQSQSVLPNGDAKVKNEL iaa3_arath Auxin-responsive protein IAA3 IAA3 SHY2 At1g04240 F19P19.32 Indoleacetic acid-induced protein 3 Short hypocotyl Suppressor of HY2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDEFVNLKETELRLGLPGTDNVCEAKERVSCCNNNNKRVLSTDTEKEIESSSRKTETSPPRKAQIVGWPPVRSYRKNNIQSKKNESEHEGQGIYVKVSMDGAPYLRKIDLSCYKGYSELLKALEVMFKFSVGEYFERDGYKGSDFVPTYEDKDGDWMLIGDVPWEMFICTCKRLRIMKGSEAKGLGCGV iaa7_arath Auxin-responsive protein IAA7 Indoleacetic acid-induced protein 7 Auxin resistant 2 IAA7 AXR2 At3g23050 MXC7.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIGQLMNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVPKEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNRS med21-tpl-1 4058989 N/A 4058995 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus ubiquitin reconstruction tag ubiquitin reconstruction tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4058996 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q94AI7:p.Val145Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q94AI7:p.Glu146Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q94AI7:p.Lys148Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q94AI7:p.Lys149Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q94AI7:p.[Val145_Glu146delinsAlaAla;Lys148_Lys149delinsAlaAla] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminus ubiquitin reconstruction tag ubiquitin reconstruction tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 2a, 2e, 3d, Figure 2 - Figure Supplement 1b med10b-tpl-1 4058989 N/A 4058997 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus ubiquitin reconstruction tag ubiquitin reconstruction tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4058996 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminus ubiquitin reconstruction tag ubiquitin reconstruction tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q94AI7:p.[Val145_Glu146delinsAlaAla;Lys148_Lys149delinsAlaAla] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2c, 2d-e, Figure 2 - Figure Supplement 1d iaa3-tpl-1 4058989 N/A 4058996 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false c-terminus ubiquitin reconstruction tag ubiquitin reconstruction tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 4058998 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus ubiquitin reconstruction tag ubiquitin reconstruction tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2a, 2e, Figure 2 - Figure Supplement 1b-c tpl-tpl-3 4058989 N/A 4058996 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus ubiquitin reconstruction tag ubiquitin reconstruction tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 4058996 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed LisH domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false c-terminus ubiquitin reconstruction tag ubiquitin reconstruction tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false H1-H9 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q94AI7:p.[Val145_Glu146delinsAlaAla;Lys148_Lys149delinsAlaAla] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q94AI7:p.Val145Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q94AI7:p.Glu146Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q94AI7:p.Lys148Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q94AI7:p.Lys149Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2a, 2c-d, 3d, Figure 2 - Figure Supplement 1a-d tpl-tpl-4 4058989 N/A 4058996 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q94AI7:p.[Ser5Ala;Leu8Ser;Phe15Tyr;Glu19Ser;Lys102Ser;Thr116_Gln117delinsAlaSer;Glu122Ser] monomer mutation mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c-terminus ubiquitin reconstruction tag ubiquitin reconstruction tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 4058996 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q94AI7:p.[Ser5Ala;Leu8Ser;Phe15Tyr;Glu19Ser;Lys102Ser;Thr116_Gln117delinsAlaSer;Glu122Ser] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminus ubiquitin reconstruction tag ubiquitin reconstruction tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q94AI7:p.[Lys102Ser;Thr116_Gln117delinsAlaSer;Glu122Ser] LDimer mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5I-1 TPL Monomer bait and TPL LDimer, monomer prey tpl-tpl-5 4058989 N/A 4058996 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminus ubiquitin reconstruction tag ubiquitin reconstruction tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 4058996 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q94AI7:p.[Ser5Ala;Leu8Ser;Phe15Tyr;Glu19Ser;Lys102Ser;Thr116_Gln117delinsAlaSer;Glu122Ser] Monomer mutations mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c-terminus ubiquitin reconstruction tag ubiquitin reconstruction tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5I-2 TPL monomer bait and TPL prey tpl-med21-2 4058989 N/A 4058995 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus ubiquitin reconstruction tag ubiquitin reconstruction tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 4058996 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed H1-H9 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false H1-H7 domain required to bind necessary binding region required to bind certain certain sequence position certain range range false c-terminus ubiquitin reconstruction tag ubiquitin reconstruction tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figure 2 - Figure Supplement 1c tpl-tpl-7 4058989 N/A 4058996 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminus ubiquitin reconstruction tag ubiquitin reconstruction tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 4058996 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminus ubiquitin reconstruction tag ubiquitin reconstruction tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 5I-3 med21-tpl-2 4058990 N/A 4058995 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4058996 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false tag lexa dna bd lexa dna binding domain lexa dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tag vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tag protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2d med10b-tpl-2 4058990 N/A 4058997 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4058996 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tag vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tag protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tag lexa dna bd lexa dna binding domain lexa dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2d tpl-tpl-8 4058990 N/A 4058996 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4058996 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false tag lexa dna bd lexa dna binding domain lexa dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tag vp16 ad vp16 activation domain vp16 ad undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tag protein a tag protein a tag protein A protein A undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2d tpl-tpl-6 4058991 N/A 4058996 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N-terminal region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 4058996 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 2 - Figure Supplement 1. tpl-iaa7-1 4058991 N/A 4058999 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 4058996 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 2 - Figure Supplement 1a tpl-med21-1 4058991 N/A 4058995 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 4058996 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N-terminal region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 2 - Figure Supplement 1a med21-tpl-3 4058992 N/A 4058995 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 4058996 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell n-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q94AI7:p.[Val145_Glu146delinsAlaAla;Lys148_Lys149delinsAlaAla] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 6a tpl-tpl-2 4058992 N/A 4058996 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 4058996 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell n-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 6a med21-tpl-4 4058993 N/A 4058995 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4058996 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 6b med10b-med21-1 4058993 N/A 4058995 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4058997 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4058996 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Figure 6 - Figure Supplement 1 tpl-1 4058994 N/A 4058996 unspecified role unspecified role neutral component neutral component purified purified tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 direct interaction direct interaction false false false 5h tpl-4 4058994 N/A 4058996 unspecified role unspecified role neutral component neutral component purified purified Q94AI7:p.[Lys102Ser;Thr116_Gln117delinsAlaSer;Glu122Ser] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q94AI7:p.[Ser5Ala;Leu8Ser;Phe15Tyr;Glu19Ser;Lys102Ser;Thr116_Gln117delinsAlaSer;Glu122Ser] monomer mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false 5h