IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhang-2021-9 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Zhang Y., Chen Y., Li Y., Huang F., Luo B., Yuan Y., Xia B., Ma X., Yang T., Yu F., Liu J., Liu B., Song Z., Chen J., Yan S., Wu L., Pan T., Zhang X., Li R., Huang W., He X., Xiao F., Zhang J., Zhang H., Zhang Y., Chen Y., Li Y., Huang F., Luo B., Yuan Y., Xia B., Ma X., Yang T., Yu F., Liu J., Liu B., Song Z., Chen J., Yan S., Wu L., Pan T., Zhang X., Li R., Huang W., He X., Xiao F., Zhang J., Zhang H. Virus - Publications including interactions involving viral proteins zhangh92@mail.sysu.edu.cn,zhangjuns_0953@163.com Proceedings of the National Academy of Sciences of the United States of America 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus zhang-2021-10 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Zhang Y., Chen Y., Li Y., Huang F., Luo B., Yuan Y., Xia B., Ma X., Yang T., Yu F., Liu J., Liu B., Song Z., Chen J., Yan S., Wu L., Pan T., Zhang X., Li R., Huang W., He X., Xiao F., Zhang J., Zhang H., Zhang Y., Chen Y., Li Y., Huang F., Luo B., Yuan Y., Xia B., Ma X., Yang T., Yu F., Liu J., Liu B., Song Z., Chen J., Yan S., Wu L., Pan T., Zhang X., Li R., Huang W., He X., Xiao F., Zhang J., Zhang H. Virus - Publications including interactions involving viral proteins zhangh92@mail.sysu.edu.cn,zhangjuns_0953@163.com Proceedings of the National Academy of Sciences of the United States of America 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus zhang-2021-11 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Zhang Y., Chen Y., Li Y., Huang F., Luo B., Yuan Y., Xia B., Ma X., Yang T., Yu F., Liu J., Liu B., Song Z., Chen J., Yan S., Wu L., Pan T., Zhang X., Li R., Huang W., He X., Xiao F., Zhang J., Zhang H., Zhang Y., Chen Y., Li Y., Huang F., Luo B., Yuan Y., Xia B., Ma X., Yang T., Yu F., Liu J., Liu B., Song Z., Chen J., Yan S., Wu L., Pan T., Zhang X., Li R., Huang W., He X., Xiao F., Zhang J., Zhang H. Virus - Publications including interactions involving viral proteins Cells were treated with cross-linker DSP (dithiobis(succinimidyl propionate)) and co-IP-ed with the anti–HA-tag beads. zhangh92@mail.sysu.edu.cn,zhangjuns_0953@163.com Proceedings of the National Academy of Sciences of the United States of America 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus zhang-2021-12 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang Y., Chen Y., Li Y., Huang F., Luo B., Yuan Y., Xia B., Ma X., Yang T., Yu F., Liu J., Liu B., Song Z., Chen J., Yan S., Wu L., Pan T., Zhang X., Li R., Huang W., He X., Xiao F., Zhang J., Zhang H., Zhang Y., Chen Y., Li Y., Huang F., Luo B., Yuan Y., Xia B., Ma X., Yang T., Yu F., Liu J., Liu B., Song Z., Chen J., Yan S., Wu L., Pan T., Zhang X., Li R., Huang W., He X., Xiao F., Zhang J., Zhang H. Virus - Publications including interactions involving viral proteins zhangh92@mail.sysu.edu.cn,zhangjuns_0953@163.com Proceedings of the National Academy of Sciences of the United States of America 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus 1a02_human HLA class I histocompatibility antigen, A-2 alpha chain HLA-A HLAA Human leukocyte antigen A*02 protein protein human Homo sapiens Human MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRKGGSYSQAASSDSAQGSDVSLTACKV Deprecated HLA-A AC, merged into a different UniProt canonical but we have mutation features in variable positions. Allele =A*02:01:01:01 Allele =A*02:01:01:01 according to IPD-IMGT/HLA database ns8_sars2 ORF8 protein Non-structural protein 8 8 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK hla_a-ns8_sars2-1 4059656 N/A 4059660 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4059661 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed P0DTC8:p.Leu84Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 1 F/G ORF8 overexpression in the HEK293T cells significantly down-regulated MHC-Ι (HLA-A2) expression. hla_a-ns8_sars2-4 4059656 N/A 4059660 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4059661 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Supp. figure 1 E-F hla_a-ns8_sars2-2 4059657 N/A 4059660 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4059661 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 4E becn1-ns8_sars2-1 4059657 N/A 4059662 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 4059661 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 5H hla_a-ns8_sars2-3 4059658 N/A 4059660 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4059661 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4F ns8_sars2-becn1-1 4059658 N/A 4059662 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4059661 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5I ns8_sars2-hla_a-1 4059659 N/A 4059660 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 4059661 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4G